Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Histone H2B Rabbit pAb (APR24497N)

Product Specifications

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a replication-dependent histone that is a member of the histone H2B family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif. The protein has antibacterial and antifungal antimicrobial activity.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Histone H2B Rabbit pAb (APR24497N) .

Synonyms

GL105; H2B; H2B.1; H2BFQ; H2BGL105; H2BQ; Histone H2B; HIST2H2BE

Gene ID

8349

UniProt

Q16778

Cellular Locus

Chromosome, Nucleus

Applications

WB (Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 13kDa Observed MW: 14KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8349

Uniprot URL

https://www.uniprot.org/uniprot/Q16778

AA Sequence

MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PENAAV-Itga2b (mouse) -FLAG
BZ58392 1 Vial

PENAAV-Itga2b (mouse) -FLAG

Sign In for Pricing
View Details
3-[5- (Chloromethyl) -1,2,4-oxadiazol-3-yl]-6-methoxypyridazine
USC34167-01 50 mg

3-[5- (Chloromethyl) -1,2,4-oxadiazol-3-yl]-6-methoxypyridazine

Sign In for Pricing
View Details
3-[5- (Chloromethyl) -1,2,4-oxadiazol-3-yl]-6-methoxypyridazine
USC34167-02 0.5 g

3-[5- (Chloromethyl) -1,2,4-oxadiazol-3-yl]-6-methoxypyridazine

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae Redox-sensing transcriptional repressor rex (rex)
MBS1190496-01 0.02 mg (E-Coli)

Recombinant Streptococcus pneumoniae Redox-sensing transcriptional repressor rex (rex)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae Redox-sensing transcriptional repressor rex (rex)
MBS1190496-02 0.1 mg (E-Coli)

Recombinant Streptococcus pneumoniae Redox-sensing transcriptional repressor rex (rex)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae Redox-sensing transcriptional repressor rex (rex)
MBS1190496-03 0.02 mg (Yeast)

Recombinant Streptococcus pneumoniae Redox-sensing transcriptional repressor rex (rex)

Sign In for Pricing
View Details