Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC27 Rabbit pAb (APR24494N)

Product Specifications

Background

The protein encoded by this gene shares strong similarity with Saccharomyces cerevisiae protein Cdc27, and the gene product of Schizosaccharomyces pombe nuc 2. This protein is a component of the anaphase-promoting complex (APC), which is composed of eight protein subunits and is highly conserved in eukaryotic cells. This complex catalyzes the formation of cyclin B-ubiquitin conjugate, which is responsible for the ubiquitin-mediated proteolysis of B-type cyclins. The protein encoded by this gene and three other members of the APC complex contain tetratricopeptide (TPR) repeats, which are important for protein-protein interactions. This protein was shown to interact with mitotic checkpoint proteins including Mad2, p55CDC and BUBR1, and it may thus be involved in controlling the timing of mitosis. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 2, 22 and Y.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CDC27 Rabbit pAb (APR24494N) .

Synonyms

CDC27; ANAPC3; APC3; CDC27Hs; D0S1430E; D17S978E; H-NUC; HNUC; NUC2

Gene ID

996

UniProt

P30260

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 91kDa/92kDa Observed MW: 110kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=996

Uniprot URL

https://www.uniprot.org/uniprot/P30260

AA Sequence

HLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTC33 Antibody, Biotin conjugated
A58475-100UG 100 µg

TTC33 Antibody, Biotin conjugated

Sign In for Pricing
View Details
FREAC3 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb1572562 100 µL

FREAC3 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
GM11437 siRNA (Mouse)
MBS8231561-01 15 nmol

GM11437 siRNA (Mouse)

Sign In for Pricing
View Details
GM11437 siRNA (Mouse)
MBS8231561-02 30 nmol

GM11437 siRNA (Mouse)

Sign In for Pricing
View Details
GM11437 siRNA (Mouse)
MBS8231561-03 5x 30 nmol

GM11437 siRNA (Mouse)

Sign In for Pricing
View Details
C21orf111 siRNA Oligos set (Human)
53735171 3x 5 nmol

C21orf111 siRNA Oligos set (Human)

Sign In for Pricing
View Details