Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2D1 Rabbit pAb (APR24491N)

Product Specifications

Background

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is closely related to a stimulator of iron transport (SFT), and is up-regulated in hereditary hemochromatosis. It also functions in the ubiquitination of the tumor-suppressor protein p53 and the hypoxia-inducible transcription factor HIF1alpha by interacting with the E1 ubiquitin-activating enzyme and the E3 ubiquitin-protein ligases. Two transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality UBE2D1 Rabbit pAb (APR24491N) .

Synonyms

UBE2D1; E2 (17) KB1; SFT; UBC4/5; UBCH5; UBCH5A

Gene ID

7321

UniProt

P51668

Cellular Locus

Cytoplasm

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 16kDa Observed MW: 14kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7321

Uniprot URL

https://www.uniprot.org/uniprot/P51668

AA Sequence

MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLAF7 Rabbit Polyclonal Antibody
MBS9517005-01 0.05 mL

SLAF7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SLAF7 Rabbit Polyclonal Antibody
MBS9517005-02 0.1 mL

SLAF7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SLAF7 Rabbit Polyclonal Antibody
MBS9517005-03 5x 0.1 mL

SLAF7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UFC1 Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-8372R-PE-Cy5.5 100 µL

UFC1 Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
Onartuzumab Biosimilar - Research Grade
ICH5212-100mg 100 mg

Onartuzumab Biosimilar - Research Grade

Sign In for Pricing
View Details
Anti-human IL-6 / IFNb2 (Chugai SK2 Biosimilar)
BIO0669SM-1mg 1 mg

Anti-human IL-6 / IFNb2 (Chugai SK2 Biosimilar)

Sign In for Pricing
View Details