Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Glypican 3 (GPC3) Rabbit pAb (APR24488N)

Product Specifications

Background

Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. The protein encoded by this gene can bind to and inhibit the dipeptidyl peptidase activity of CD26, and it can induce apoptosis in certain cell types. Deletion mutations in this gene are associated with Simpson-Golabi-Behmel syndrome, also known as Simpson dysmorphia syndrome. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Glypican 3 (GPC3) Rabbit pAb (APR24488N) .

Synonyms

GPC3; DGSX; GTR2-2; MXR7; OCI-5; SDYS; SGB; SGBS; SGBS1; glypican-3

Gene ID

2719

UniProt

P51654

Cellular Locus

Cell membrane, Extracellular side, GPI-anchor, Lipid-anchor, Secreted, extracellular space

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 59kDa/65kDa/68kDa Observed MW: 66KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2719

Uniprot URL

https://www.uniprot.org/uniprot/P51654

AA Sequence

VEIDKYWREYILSLEELVNGMYRIYDMENVLLGLFSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVLKVAHVEHEETLSSRRRELIQKLKSFISFYSALPGYICSHSPVAENDTLCWNGQELVERYSQKAARNGMKNQFNLHELKMKGPEPVVSQIIDKLKHINQLLRTMSMPKGRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEIS

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TAOK3 (Serine/threonine-protein kinase TAO3, Cutaneous T-cell lymphoma-associated antigen HD-CL-09, CTCL-associated antigen HD-CL-09, Dendritic cell-derived protein kinase, JNK/SAPK-inhibitory kinase, Jun kinase-inhibitory kinase, Kinase from chicken homo
MBS6220666-01 0.1 mL

TAOK3 (Serine/threonine-protein kinase TAO3, Cutaneous T-cell lymphoma-associated antigen HD-CL-09, CTCL-associated antigen HD-CL-09, Dendritic cell-derived protein kinase, JNK/SAPK-inhibitory kinase, Jun kinase-inhibitory kinase, Kinase from chicken homo

Ask
View Details
TAOK3 (Serine/threonine-protein kinase TAO3, Cutaneous T-cell lymphoma-associated antigen HD-CL-09, CTCL-associated antigen HD-CL-09, Dendritic cell-derived protein kinase, JNK/SAPK-inhibitory kinase, Jun kinase-inhibitory kinase, Kinase from chicken homo
MBS6220666-02 5x 0.1 mL

TAOK3 (Serine/threonine-protein kinase TAO3, Cutaneous T-cell lymphoma-associated antigen HD-CL-09, CTCL-associated antigen HD-CL-09, Dendritic cell-derived protein kinase, JNK/SAPK-inhibitory kinase, Jun kinase-inhibitory kinase, Kinase from chicken homo

Ask
View Details
Cardiac Troponin I (TNNI3) Human shRNA Plasmid Kit (Locus ID 7137)
TL308714 1 Kit

Cardiac Troponin I (TNNI3) Human shRNA Plasmid Kit (Locus ID 7137)

Ask
View Details
Mouse IL-4 protein (Animal-Free)
MBS9719049-01 0.005 mg

Mouse IL-4 protein (Animal-Free)

Ask
View Details
Mouse IL-4 protein (Animal-Free)
MBS9719049-02 0.02 mg

Mouse IL-4 protein (Animal-Free)

Ask
View Details
Mouse IL-4 protein (Animal-Free)
MBS9719049-03 0.1 mg

Mouse IL-4 protein (Animal-Free)

Ask
View Details