Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRIK2 Rabbit pAb (APR24481N)

Product Specifications

Background

Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. This gene product belongs to the kainate family of glutamate receptors, which are composed of four subunits and function as ligand-activated ion channels. The subunit encoded by this gene is subject to RNA editing at multiple sites within the first and second transmembrane domains, which is thought to alter the structure and function of the receptor complex. Alternatively spliced transcript variants encoding different isoforms have also been described for this gene. Mutations in this gene have been associated with autosomal recessive mental retardation.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GRIK2 Rabbit pAb (APR24481N) .

Synonyms

GRIK2; EAA4; GLR6; GLUK6; GLUR6; GluK2; MRT6; kainate 2

Gene ID

2898

UniProt

Q13002

Cellular Locus

Cell junction, Cell membrane, Multi-pass membrane protein, postsynaptic cell membrane, synapse

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 66kDa/77kDa/93kDa/97kDa/100kDa/102kDa Observed MW: 115kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2898

Uniprot URL

https://www.uniprot.org/uniprot/Q13002

AA Sequence

QGTTHVLRFGGIFEYVESGPMGAEELAFRFAVNTINRNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRYSGVNMTGFRILNTENTQVSSIIEKWSMER

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RIOK1 / Serine/threonine-protein kinase RIO1 Recombinant Protein
R2242h 1 Each

Human RIOK1 / Serine/threonine-protein kinase RIO1 Recombinant Protein

Sign In for Pricing
View Details
LRRC3C Antibody, Biotin Conjugated
MBS7134406-01 0.05 mL

LRRC3C Antibody, Biotin Conjugated

Sign In for Pricing
View Details
LRRC3C Antibody, Biotin Conjugated
MBS7134406-02 0.1 mL

LRRC3C Antibody, Biotin Conjugated

Sign In for Pricing
View Details
LRRC3C Antibody, Biotin Conjugated
MBS7134406-03 5x 0.1 mL

LRRC3C Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Tissue, Section, Human Disease, Progressive Supranuclear Palsy, Brain, Pons (Frozen)
MBS640047-01 5 Slides

Tissue, Section, Human Disease, Progressive Supranuclear Palsy, Brain, Pons (Frozen)

Sign In for Pricing
View Details
Tissue, Section, Human Disease, Progressive Supranuclear Palsy, Brain, Pons (Frozen)
MBS640047-02 5x 5 Slides

Tissue, Section, Human Disease, Progressive Supranuclear Palsy, Brain, Pons (Frozen)

Sign In for Pricing
View Details