Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EBAG9 Rabbit pAb (APR24477N)

Product Specifications

Background

This gene was identified as an estrogen-responsive gene. Regulation of transcription by estrogen is mediated by estrogen receptor, which binds to the estrogen-responsive element found in the 5'-flanking region of this gene. The encoded protein is a tumor-associated antigen that is expressed at high frequency in a variety of cancers. Alternate splicing results in multiple transcript variants. A pseudogene of this gene has been defined on chromosome 10.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality EBAG9 Rabbit pAb (APR24477N) .

Synonyms

EBAG9; EB9; PDAF

Gene ID

9166

UniProt

O00559

Cellular Locus

Golgi apparatus membrane, Single-pass type III membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 24kDa/29kDa Observed MW: 28kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9166

Uniprot URL

https://www.uniprot.org/uniprot/O00559

AA Sequence

RSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Membrane cofactor protein (CD46), partial, Biotinylated
orb2658151-01 20 µg

Recombinant Human Membrane cofactor protein (CD46), partial, Biotinylated

Sign In for Pricing
View Details
Recombinant Human Membrane cofactor protein (CD46), partial, Biotinylated
orb2658151-02 100 µg

Recombinant Human Membrane cofactor protein (CD46), partial, Biotinylated

Sign In for Pricing
View Details
Recombinant Human Membrane cofactor protein (CD46), partial, Biotinylated
orb2658151-03 1 mg

Recombinant Human Membrane cofactor protein (CD46), partial, Biotinylated

Sign In for Pricing
View Details
Acacia enzyme free AR (Meets Analytical Specification of IP, B.P., U.S.P., N.F., Ph.EVR.)
450005 500 g

Acacia enzyme free AR (Meets Analytical Specification of IP, B.P., U.S.P., N.F., Ph.EVR.)

Sign In for Pricing
View Details
CtIP (D-4) PE
sc-271339 PE 200 µg/mL

CtIP (D-4) PE

Sign In for Pricing
View Details
ERI1 Antibody
OACD00696-1ML 1 mL

ERI1 Antibody

Sign In for Pricing
View Details