Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BST2 Rabbit pAb (APR24457N)

Product Specifications

Background

Bone marrow stromal cells are involved in the growth and development of B-cells. The specific function of the protein encoded by the bone marrow stromal cell antigen 2 is undetermined; however, this protein may play a role in pre-B-cell growth and in rheumatoid arthritis.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality BST2 Rabbit pAb (APR24457N) .

Synonyms

BST2; CD317; TETHERIN

Gene ID

684

UniProt

Q10589

Cellular Locus

Apical cell membrane, Cell membrane, Cytoplasm, GPI-anchor, Golgi apparatus, Late endosome, Lipid-anchor, Membrane raft, Single-pass type II membrane protein, trans-Golgi network

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 18kDa/19kDa Observed MW: 36kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=684

Uniprot URL

https://www.uniprot.org/uniprot/Q10589

AA Sequence

NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ORAI1 AAV Vector (Human) (CMV)
35720102 1 µg

ORAI1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Lentiviral human IL23R sgRNA gene knockout kit - Lentiviral human IL23R sgRNA gene knockout kit (100)
GTR15380914 1 Vial

Lentiviral human IL23R sgRNA gene knockout kit - Lentiviral human IL23R sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
PNOC, ID (PNOC, OFQ, Prepronociceptin, Neuropeptide 1, Nociceptin, Orphanin FQ, PPNOC, Neuropeptide 2) (AP)
MBS6335356-01 0.2 mL

PNOC, ID (PNOC, OFQ, Prepronociceptin, Neuropeptide 1, Nociceptin, Orphanin FQ, PPNOC, Neuropeptide 2) (AP)

Sign In for Pricing
View Details
PNOC, ID (PNOC, OFQ, Prepronociceptin, Neuropeptide 1, Nociceptin, Orphanin FQ, PPNOC, Neuropeptide 2) (AP)
MBS6335356-02 5x 0.2 mL

PNOC, ID (PNOC, OFQ, Prepronociceptin, Neuropeptide 1, Nociceptin, Orphanin FQ, PPNOC, Neuropeptide 2) (AP)

Sign In for Pricing
View Details
UltraCruz® Flask, Suspension Culture, 250ml, 75cm2, vent cap, case
sc-200259 100/Case

UltraCruz® Flask, Suspension Culture, 250ml, 75cm2, vent cap, case

Sign In for Pricing
View Details
High Accuracy Buffer Solution pH 9.000 ± 0.002 @ 25°c Traceable to NIST
B0055 00500 500 mL

High Accuracy Buffer Solution pH 9.000 ± 0.002 @ 25°c Traceable to NIST

Sign In for Pricing
View Details