Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL11 Rabbit pAb (APR24446N)

Product Specifications

Background

The protein encoded by this gene is a member of the gp130 family of cytokines. These cytokines drive the assembly of multisubunit receptor complexes, all of which contain at least one molecule of the transmembrane signaling receptor IL6ST (gp130) . This cytokine is shown to stimulate the T-cell-dependent development of immunoglobulin-producing B cells. It is also found to support the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality IL11 Rabbit pAb (APR24446N) .

Synonyms

IL11; AGIF; IL-11

Gene ID

3589

UniProt

P20809

Cellular Locus

Secreted

Applications

WB (Homo sapiens, Mus musculus) IHC (Homo sapiens, Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 12kDa/21kDa Observed MW: 25KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3589

Uniprot URL

https://www.uniprot.org/uniprot/P20809

AA Sequence

PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1300010F03Rik 3'UTR GFP Stable Cell Line
TU150085 1.0 mL

1300010F03Rik 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Pqlc3 siRNA Oligos set (Rat)
37519176 3x 5 nmol

Pqlc3 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
SS18 Adenovirus (Mouse)
45528055 1.0 mL

SS18 Adenovirus (Mouse)

Sign In for Pricing
View Details
CD1A Antibody (YA3379, Rabbit)
HY-P83634-01 10 µL

CD1A Antibody (YA3379, Rabbit)

Sign In for Pricing
View Details
CD1A Antibody (YA3379, Rabbit)
HY-P83634-02 50 μL

CD1A Antibody (YA3379, Rabbit)

Sign In for Pricing
View Details
CD1A Antibody (YA3379, Rabbit)
HY-P83634-03 100 µL

CD1A Antibody (YA3379, Rabbit)

Sign In for Pricing
View Details