Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL24 Rabbit pAb (APR24426N)

Product Specifications

Background

This gene encodes a member of the IL10 family of cytokines. It was identified as a gene induced during terminal differentiation in melanoma cells. The protein encoded by this gene can induce apoptosis selectively in various cancer cells. Overexpression of this gene leads to elevated expression of several GADD family genes, which correlates with the induction of apoptosis. The phosphorylation of mitogen-activated protein kinase 14 (MAPK7/P38), and heat shock 27kDa protein 1 (HSPB2/HSP27) are found to be induced by this gene in melanoma cells, but not in normal immortal melanocytes. Alternatively spliced transcript variants encoding distinct isoforms have been reported.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality IL24 Rabbit pAb (APR24426N) .

Synonyms

IL24; C49A; FISP; IL10B; MDA7; MOB5; ST16

Gene ID

11009

UniProt

Q13007

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 7kDa/17kDa/23kDa Observed MW: 26kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=11009

Uniprot URL

https://www.uniprot.org/uniprot/Q13007

AA Sequence

GQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prdm9 3'UTR GFP Stable Cell Line
TU166906 1.0 mL

Prdm9 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Lentiviral mouse Coro6 shRNA (UAS) - Lentiviral mouse Coro6 shRNA (UAS, GFP) plasmid
GTR15275230 1 Vial

Lentiviral mouse Coro6 shRNA (UAS) - Lentiviral mouse Coro6 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Chicken Anti Cyclical Citrullinated Peptide Antibody (ACPA) ELISA Kit
MBS2607152-01 48 Well

Chicken Anti Cyclical Citrullinated Peptide Antibody (ACPA) ELISA Kit

Sign In for Pricing
View Details
Chicken Anti Cyclical Citrullinated Peptide Antibody (ACPA) ELISA Kit
MBS2607152-02 96 Well

Chicken Anti Cyclical Citrullinated Peptide Antibody (ACPA) ELISA Kit

Sign In for Pricing
View Details
Chicken Anti Cyclical Citrullinated Peptide Antibody (ACPA) ELISA Kit
MBS2607152-03 5x 96 Well

Chicken Anti Cyclical Citrullinated Peptide Antibody (ACPA) ELISA Kit

Sign In for Pricing
View Details
Chicken Anti Cyclical Citrullinated Peptide Antibody (ACPA) ELISA Kit
MBS2607152-04 10x 96 Well

Chicken Anti Cyclical Citrullinated Peptide Antibody (ACPA) ELISA Kit

Sign In for Pricing
View Details