Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPRY2 Rabbit pAb (APR24405N)

Product Specifications

Background

This gene encodes a protein belonging to the sprouty family. The encoded protein contains a carboxyl-terminal cysteine-rich domain essential for the inhibitory activity on receptor tyrosine kinase signaling proteins and is required for growth factor stimulated translocation of the protein to membrane ruffles. In primary dermal endothelial cells this gene is transiently upregulated in response to fibroblast growth factor two. This protein is indirectly involved in the non-cell autonomous inhibitory effect on fibroblast growth factor two signaling. The protein interacts with Cas-Br-M (murine) ectropic retroviral transforming sequence, and can function as a bimodal regulator of epidermal growth factor receptor/mitogen-activated protein kinase signaling. This protein may play a role in alveoli branching during lung development as shown by a similar mouse protein.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SPRY2 Rabbit pAb (APR24405N) .

Synonyms

SPRY2; IGAN3; hSPRY2

Gene ID

10253

UniProt

O43597

Cellular Locus

Cell projection, Cytoplasm, cytoskeleton, ruffle membrane

Applications

WB (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 34kDa Observed MW: 38kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10253

Uniprot URL

https://www.uniprot.org/uniprot/O43597

AA Sequence

MEARAQSGNGSQPLLQTPRDGGRQRGEPDPRDALTQQVHVLSLDQIRAIRNTNEYTEGPTVVPRPGLKPAPRPSTQHKHERLHGLPEHRQPPRLQHSQVH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXO32 (F-box Only Protein 32, Atrogin-1, Muscle Atrophy F-box Protein, MAFbx) (MaxLight 650)
MBS6222149-01 0.1 mL

FBXO32 (F-box Only Protein 32, Atrogin-1, Muscle Atrophy F-box Protein, MAFbx) (MaxLight 650)

Sign In for Pricing
View Details
FBXO32 (F-box Only Protein 32, Atrogin-1, Muscle Atrophy F-box Protein, MAFbx) (MaxLight 650)
MBS6222149-02 5x 0.1 mL

FBXO32 (F-box Only Protein 32, Atrogin-1, Muscle Atrophy F-box Protein, MAFbx) (MaxLight 650)

Sign In for Pricing
View Details
Furnace 5ltr CWF13/5/PID301
FUR1229 1 Each

Furnace 5ltr CWF13/5/PID301

Sign In for Pricing
View Details
Human Fibrous Sheath Interacting Protein 1 (FSIP1) ELISA Kit
DLR-FSIP1-Hu-48T 48 Tests

Human Fibrous Sheath Interacting Protein 1 (FSIP1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal SLC45A4 Antibody [DyLight 550]
NBP2-98631R 0.1 mL

Rabbit Polyclonal SLC45A4 Antibody [DyLight 550]

Sign In for Pricing
View Details
Human THTPA Matched Antibody Pair Set [Poly/Poly] (Z01LS-1122-LS352)
Z01LS-1122-LS352 5 Plates

Human THTPA Matched Antibody Pair Set [Poly/Poly] (Z01LS-1122-LS352)

Sign In for Pricing
View Details