Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTGIR Rabbit pAb (APR24400N)

Product Specifications

Background

The protein encoded by this gene is a member of the G-protein coupled receptor family 1 and has been shown to be a receptor for prostacyclin. Prostacyclin, the major product of cyclooxygenase in macrovascular endothelium, elicits a potent vasodilation and inhibition of platelet aggregation through binding to this receptor.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PTGIR Rabbit pAb (APR24400N) .

Synonyms

PTGIR; IP; PRIPR

Gene ID

5739

UniProt

P43119

Cellular Locus

Cell membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 40kDa Observed MW: 41kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5739

Uniprot URL

https://www.uniprot.org/uniprot/P43119

AA Sequence

TLSLCRMYRQQKRHQGSLGPRPRTGEDEVDHLILLALMTVVMAVCSLPLTIRCFTQAVAPDSSSEMGDLLAFRFYAFNPILDPWVFILFRKAVFQRLKLWVCCLCLGPAHGDSQTPLSQLASGRRDPRAPSAPVGKEGSCVPLSAWGEGQVEPLPPTQQSSGSAVGTSSKAEASVACSLC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Membrane Protein Human XK (X-linked Kx blood group) Full Length
MPC4287K Each

Magic™ Membrane Protein Human XK (X-linked Kx blood group) Full Length

Sign In for Pricing
View Details
Recombinant Photorhabdus luminescens subsp. laumondii UPF0270 protein plu0398 (plu0398)
MBS1325486-01 0.02 mg (E-Coli)

Recombinant Photorhabdus luminescens subsp. laumondii UPF0270 protein plu0398 (plu0398)

Sign In for Pricing
View Details
Recombinant Photorhabdus luminescens subsp. laumondii UPF0270 protein plu0398 (plu0398)
MBS1325486-02 0.1 mg (E-Coli)

Recombinant Photorhabdus luminescens subsp. laumondii UPF0270 protein plu0398 (plu0398)

Sign In for Pricing
View Details
Recombinant Photorhabdus luminescens subsp. laumondii UPF0270 protein plu0398 (plu0398)
MBS1325486-03 0.02 mg (Yeast)

Recombinant Photorhabdus luminescens subsp. laumondii UPF0270 protein plu0398 (plu0398)

Sign In for Pricing
View Details
Recombinant Photorhabdus luminescens subsp. laumondii UPF0270 protein plu0398 (plu0398)
MBS1325486-04 0.1 mg (Yeast)

Recombinant Photorhabdus luminescens subsp. laumondii UPF0270 protein plu0398 (plu0398)

Sign In for Pricing
View Details
Recombinant Photorhabdus luminescens subsp. laumondii UPF0270 protein plu0398 (plu0398)
MBS1325486-05 0.02 mg (Baculovirus)

Recombinant Photorhabdus luminescens subsp. laumondii UPF0270 protein plu0398 (plu0398)

Sign In for Pricing
View Details