Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDB2 Rabbit pAb (APR24399N)

Product Specifications

Background

This gene encodes a protein that is necessary for the repair of ultraviolet light-damaged DNA. This protein is the smaller subunit of a heterodimeric protein complex that participates in nucleotide excision repair, and this complex mediates the ubiquitylation of histones H3 and H4, which facilitates the cellular response to DNA damage. This subunit appears to be required for DNA binding. Mutations in this gene cause xeroderma pigmentosum complementation group E, a recessive disease that is characterized by an increased sensitivity to UV light and a high predisposition for skin cancer development, in some cases accompanied by neurological abnormalities. Two transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DDB2 Rabbit pAb (APR24399N) .

Synonyms

DDB2; DDBB; UV-DDB2; XPE

Gene ID

1643

UniProt

Q92466

Cellular Locus

Nucleus

Applications

IF (Homo sapiens, Mus musculus) WB (Mus musculus)

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 17kDa/26kDa/40kDa/47kDa Observed MW: 48kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1643

Uniprot URL

https://www.uniprot.org/uniprot/Q92466

AA Sequence

MAPKKRPETQKTSEIVLRPRNKRSRSPLELEPEAKKLCAKGSGPSRRCDSDCLWVGLAGPQILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWHPTHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGTTRLQDFKGNILRVFASSDTINIWFCSLDVSASSRMVVTGDNVGNVILLNMDGKELWNLRMHKKKVTHVALNPCCDWFLATASVDQTVKIWDLRQVRGKASFLYSLPHRHPVNAACFSPDGARLLTTDQKSEIRVY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLK11 Protein Lysate
OCOA19962-20UG 20 µg

KLK11 Protein Lysate

Sign In for Pricing
View Details
CYCSP34 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV759652 1.0 µg DNA

CYCSP34 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Vmn1r51 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
49678114 3x 1.0 µg

Vmn1r51 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
AHCYL1 (Putative Adenosylhomocysteinase 2, AdoHcyase 2, DC-expressed AHCY-like Molecule, S-adenosyl-L-homocysteine Hydrolase 2, S-adenosylhomocysteine Hydrolase-like Protein 1, DCAL, XPVKONA) (AP)
MBS6129917-01 0.1 mL

AHCYL1 (Putative Adenosylhomocysteinase 2, AdoHcyase 2, DC-expressed AHCY-like Molecule, S-adenosyl-L-homocysteine Hydrolase 2, S-adenosylhomocysteine Hydrolase-like Protein 1, DCAL, XPVKONA) (AP)

Sign In for Pricing
View Details
AHCYL1 (Putative Adenosylhomocysteinase 2, AdoHcyase 2, DC-expressed AHCY-like Molecule, S-adenosyl-L-homocysteine Hydrolase 2, S-adenosylhomocysteine Hydrolase-like Protein 1, DCAL, XPVKONA) (AP)
MBS6129917-02 5x 0.1 mL

AHCYL1 (Putative Adenosylhomocysteinase 2, AdoHcyase 2, DC-expressed AHCY-like Molecule, S-adenosyl-L-homocysteine Hydrolase 2, S-adenosylhomocysteine Hydrolase-like Protein 1, DCAL, XPVKONA) (AP)

Sign In for Pricing
View Details
S-RMab® Helicobacter pylori Recombinant Rabbit mAb (FITC Conjugate) (S-R273)
S0B0158-01 1 mL

S-RMab® Helicobacter pylori Recombinant Rabbit mAb (FITC Conjugate) (S-R273)

Sign In for Pricing
View Details