Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLR2J Rabbit pAb (APR24394N)

Product Specifications

Background

This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene exists as a heterodimer with another polymerase subunit; together they form a core subassembly unit of the polymerase. Two similar genes are located nearby on chromosome 7q22.1 and a pseudogene is found on chromosome 7p13.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality POLR2J Rabbit pAb (APR24394N) .

Synonyms

POLR2J; POLR2J1; RPB11; RPB11A; RPB11m; hRPB14

Gene ID

5439

UniProt

P52435

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 13kDa Observed MW: 16kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5439

Uniprot URL

https://www.uniprot.org/uniprot/P52435

AA Sequence

MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to Octamer Binding Transcription Factor 4 (OCT4)
MBS2151686-01 0.1 mL

Monoclonal Antibody to Octamer Binding Transcription Factor 4 (OCT4)

Sign In for Pricing
View Details
Monoclonal Antibody to Octamer Binding Transcription Factor 4 (OCT4)
MBS2151686-02 0.2 mL

Monoclonal Antibody to Octamer Binding Transcription Factor 4 (OCT4)

Sign In for Pricing
View Details
Monoclonal Antibody to Octamer Binding Transcription Factor 4 (OCT4)
MBS2151686-03 0.5 mL

Monoclonal Antibody to Octamer Binding Transcription Factor 4 (OCT4)

Sign In for Pricing
View Details
Monoclonal Antibody to Octamer Binding Transcription Factor 4 (OCT4)
MBS2151686-04 1 mL

Monoclonal Antibody to Octamer Binding Transcription Factor 4 (OCT4)

Sign In for Pricing
View Details
Monoclonal Antibody to Octamer Binding Transcription Factor 4 (OCT4)
MBS2151686-05 5 mL

Monoclonal Antibody to Octamer Binding Transcription Factor 4 (OCT4)

Sign In for Pricing
View Details
Monoclonal Antibody to Octamer Binding Transcription Factor 4 (OCT4)
MBS2151686-06 5x 5 mL

Monoclonal Antibody to Octamer Binding Transcription Factor 4 (OCT4)

Sign In for Pricing
View Details