Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD47 Rabbit pAb (APR24389N)

Product Specifications

Background

This gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes. Alternatively spliced transcript variants have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD47 Rabbit pAb (APR24389N) .

Synonyms

CD47; IAP; MER6; OA3

Gene ID

961

UniProt

Q08722

Cellular Locus

Cell membrane, Multi-pass membrane protein

Applications

WB (Rattus norvegicus, Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 31kDa/33kDa/35kDa Observed MW: 47KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=961

Uniprot URL

https://www.uniprot.org/uniprot/Q08722

AA Sequence

LLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCMV-H4C15-3×Myc-Neo Plasmid
PVT58895 2 µg

pCMV-H4C15-3×Myc-Neo Plasmid

Sign In for Pricing
View Details
Human ULBP1 ELISA Kit PicoKine®, Carrier-free
EK1685-carrier-free 96 Well With Removable Strips

Human ULBP1 ELISA Kit PicoKine®, Carrier-free

Sign In for Pricing
View Details
Rebeads® Mag Oligo dT
NBT501-01 1 mL

Rebeads® Mag Oligo dT

Sign In for Pricing
View Details
Rebeads® Mag Oligo dT
NBT501-02 5 mL

Rebeads® Mag Oligo dT

Sign In for Pricing
View Details
Rebeads® Mag Oligo dT
NBT501-03 50 mL

Rebeads® Mag Oligo dT

Sign In for Pricing
View Details
1- (2-fluoro-4-methyl-3- (methylthio) phenyl) cyclopentanol
PC1021252-01 250 mg

1- (2-fluoro-4-methyl-3- (methylthio) phenyl) cyclopentanol

Sign In for Pricing
View Details