Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBX1 Rabbit pAb (APR24384N)

Product Specifications

Background

This locus encodes a RING finger-like domain-containing protein. The encoded protein interacts with cullin proteins and likely plays a role in ubiquitination processes necessary for cell cycle progression. This protein may also affect protein turnover. Related pseudogenes exist on chromosomes 2 and 5.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RBX1 Rabbit pAb (APR24384N) .

Synonyms

RBX1; BA554C12.1; RNF75; ROC1

Gene ID

9978

UniProt

P62877

Cellular Locus

Cytoplasm, Nucleus

Applications

WB (Homo sapiens, Mus musculus) IP (Homo sapiens, Mus musculus) IF (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 12kDa Observed MW: 14kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9978

Uniprot URL

https://www.uniprot.org/uniprot/P62877

AA Sequence

MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zinc Transporter 2 (SLC30A2) Human ELISA Kit
I4170 96 Tests

Zinc Transporter 2 (SLC30A2) Human ELISA Kit

Sign In for Pricing
View Details
Phospho-Artemis (Ser516) Rabbit Polyclonal Antibody
APRab00839-01 20 µL

Phospho-Artemis (Ser516) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-Artemis (Ser516) Rabbit Polyclonal Antibody
APRab00839-02 50 µL

Phospho-Artemis (Ser516) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-Artemis (Ser516) Rabbit Polyclonal Antibody
APRab00839-03 100 µL

Phospho-Artemis (Ser516) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-Artemis (Ser516) Rabbit Polyclonal Antibody
APRab00839-04 200 µL

Phospho-Artemis (Ser516) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Monoclonal Antibody to Carcinoembryonic Antigen Related Cell Adhesion Molecule 7 (CEACAM7)
TRV-0059610-01 20 µL

Monoclonal Antibody to Carcinoembryonic Antigen Related Cell Adhesion Molecule 7 (CEACAM7)

Sign In for Pricing
View Details