Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBX1 Rabbit pAb (APR24384N)

Product Specifications

Background

This locus encodes a RING finger-like domain-containing protein. The encoded protein interacts with cullin proteins and likely plays a role in ubiquitination processes necessary for cell cycle progression. This protein may also affect protein turnover. Related pseudogenes exist on chromosomes 2 and 5.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RBX1 Rabbit pAb (APR24384N) .

Synonyms

RBX1; BA554C12.1; RNF75; ROC1

Gene ID

9978

UniProt

P62877

Cellular Locus

Cytoplasm, Nucleus

Applications

WB (Homo sapiens, Mus musculus) IP (Homo sapiens, Mus musculus) IF (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 12kDa Observed MW: 14kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9978

Uniprot URL

https://www.uniprot.org/uniprot/P62877

AA Sequence

MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

REV3L sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
38837111 3x 1.0 µg

REV3L sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
HDBP2(HDRF-2) Antibody (Center) Blocking Peptide
MBS9224456-01 0.5 mg

HDBP2(HDRF-2) Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
HDBP2(HDRF-2) Antibody (Center) Blocking Peptide
MBS9224456-02 5x 0.5 mg

HDBP2(HDRF-2) Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
ABCA12 CRISPRa sgRNA lentivector (set of three targets)(Human)
11011121 3x 1.0µg DNA

ABCA12 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Anti-FGFR2 (Recombinant Rabbit, Monoclonal, IgG)
A113100 100 µL

Anti-FGFR2 (Recombinant Rabbit, Monoclonal, IgG)

Sign In for Pricing
View Details
Rhesus macaque CD4 Protein, Fc Tag (MALS verified)
CD4-C5256-1mg 1 mg

Rhesus macaque CD4 Protein, Fc Tag (MALS verified)

Sign In for Pricing
View Details