Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1QA Rabbit pAb (APR24306N)

Product Specifications

Background

This gene encodes a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. This gene encodes the A-chain polypeptide of human complement subcomponent C1q.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality C1QA Rabbit pAb (APR24306N) .

Synonyms

C1QA

Gene ID

712

UniProt

P02745

Cellular Locus

Secreted

Applications

WB (Mus musculus)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 26kDa Observed MW: 25kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=712

Uniprot URL

https://www.uniprot.org/uniprot/P02745

AA Sequence

EDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bacillus clausii Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD)
MBS1479967-01 0.02 mg (E-Coli)

Recombinant Bacillus clausii Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD)

Sign In for Pricing
View Details
Recombinant Bacillus clausii Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD)
MBS1479967-02 0.02 mg (Yeast)

Recombinant Bacillus clausii Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD)

Sign In for Pricing
View Details
Recombinant Bacillus clausii Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD)
MBS1479967-03 0.1 mg (E-Coli)

Recombinant Bacillus clausii Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD)

Sign In for Pricing
View Details
Recombinant Bacillus clausii Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD)
MBS1479967-04 0.1 mg (Yeast)

Recombinant Bacillus clausii Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD)

Sign In for Pricing
View Details
Recombinant Bacillus clausii Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD)
MBS1479967-05 0.02 mg (Baculovirus)

Recombinant Bacillus clausii Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD)

Sign In for Pricing
View Details
Recombinant Bacillus clausii Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD)
MBS1479967-06 0.02 mg (Mammalian-Cell)

Recombinant Bacillus clausii Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD)

Sign In for Pricing
View Details