Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KEAP1 Rabbit pAb (APR24296N)

Product Specifications

Background

This gene encodes a protein containing KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase. Two alternatively spliced transcript variants encoding the same isoform have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality KEAP1 Rabbit pAb (APR24296N) .

Synonyms

KEAP1; INrf2; KLHL19

Gene ID

9817

UniProt

Q14145

Cellular Locus

Cytoplasm, Nucleus

Applications

WB (Homo sapiens, Gallus gallus, Rattus norvegicus, Mus musculus, Mauremys sinensis , Cyprinus carpio) IF (Mus musculus) IHC (Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 69kDa Observed MW: 60KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9817

Uniprot URL

https://www.uniprot.org/uniprot/Q14145

AA Sequence

GRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVTMEPCRKQIDQQNCTC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRMT5 (NM_020810) Human Recombinant Protein
TP760603 50 µg

TRMT5 (NM_020810) Human Recombinant Protein

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]
E-AB-F1351UP-01 25 µg

PE/Elab Fluor® 594 Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]
E-AB-F1351UP-02 100 µg

PE/Elab Fluor® 594 Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]

Sign In for Pricing
View Details
ATPAF2 Rabbit Polyclonal Antibody
TA373850 100 µL

ATPAF2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PLK5 Human Gene Knockout Kit (CRISPR)
KN233808LP 1 Kit

PLK5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS711181 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details