Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF6 Rabbit pAb (APR24277N)

Product Specifications

Background

Hemidesmosomes are structures which link the basal lamina to the intermediate filament cytoskeleton. An important functional component of hemidesmosomes is the integrin beta-4 subunit (ITGB4), a protein containing two fibronectin type III domains. The protein encoded by this gene binds to the fibronectin type III domains of ITGB4 and may help link ITGB4 to the intermediate filament cytoskeleton. The encoded protein, which is insoluble and found both in the nucleus and in the cytoplasm, can function as a translation initiation factor and prevent the association of the 40S and 60S ribosomal subunits. Multiple non-protein coding transcript variants and variants encoding two different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality EIF6 Rabbit pAb (APR24277N) .

Synonyms

EIF6; CAB; EIF3A; ITGB4BP; b (2) gcn; eIF-6; p27 (BBP) ; p27BBP

Gene ID

3692

UniProt

P56537

Cellular Locus

Cytoplasm, Nucleus, nucleolus

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 23kDa/26kDa Observed MW: 27kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3692

Uniprot URL

https://www.uniprot.org/uniprot/P56537

AA Sequence

MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIGRMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD64 Antibody, Rabbit Polyclonal
MBS8112609-01 0.1 mL

Anti-CD64 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-CD64 Antibody, Rabbit Polyclonal
MBS8112609-02 5x 0.1 mL

Anti-CD64 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
C18orf10 Rabbit Polyclonal Antibody (FITC)
orb2105325 100 µL

C18orf10 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
F7 Protein Vector (Human) (pPM-C-His)
PV051792 500 ng

F7 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Human U6 Snrna-Associated Sm-Like Protein Lsm1 (LSM1) Protein
abx690101-01 10 µg

Human U6 Snrna-Associated Sm-Like Protein Lsm1 (LSM1) Protein

Sign In for Pricing
View Details
Human U6 Snrna-Associated Sm-Like Protein Lsm1 (LSM1) Protein
abx690101-02 50 µg

Human U6 Snrna-Associated Sm-Like Protein Lsm1 (LSM1) Protein

Sign In for Pricing
View Details