Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] ATG4D Rabbit pAb (APR24207N)

Product Specifications

Background

Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene belongs to the autophagy-related protein 4 (Atg4) family of C54 endopeptidases. Members of this family encode proteins that play a role in the biogenesis of autophagosomes, which sequester the cytosol and organelles for degradation by lysosomes. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] ATG4D Rabbit pAb (APR24207N) .

Synonyms

ATG4D; APG4-D; APG4D; AUTL4

Gene ID

84971

UniProt

Q86TL0

Cellular Locus

Cytoplasm, Mitochondrion matrix

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 16kDa/52kDa Observed MW: 53kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=84971

Uniprot URL

https://www.uniprot.org/uniprot/Q86TL0

AA Sequence

MNSVSPAAAQYRSSSPEDARRRPEARRPRGPRGPDPNGLGPSGASGPALGSPGAGPSEPDEVDKFKAKFLTAWNNVKYGWVVKSRTSFSKISSIHLCGRRYRFEGEGDIQRFQRDFVSRLWLTYRRDFPPLPGGCLTSDCGWGCMLRSGQMMLAQGLLLHFLPRDWTWAEGMGLGPPELSGSASPSRYHGPARWMPPRWAQGAPELEQERRHRQIVSWFADHPRAPFGLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ext1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4003906 1.0 µg DNA

Ext1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
1- (3,4-Dichlorophenyl) but-3-en-1-amine hydrochloride
OR1050926-01 100 mg

1- (3,4-Dichlorophenyl) but-3-en-1-amine hydrochloride

Sign In for Pricing
View Details
1- (3,4-Dichlorophenyl) but-3-en-1-amine hydrochloride
OR1050926-02 250 mg

1- (3,4-Dichlorophenyl) but-3-en-1-amine hydrochloride

Sign In for Pricing
View Details
Sulfotransferase 4A1 (ST4A1, SULT4A1, Brain Sulfotransferase-like Protein, BRSTL1, BR-STL-1, hBR-STL, hBR-STL-1, Nervous System Sulfotransferase, NST, SULTX3, DJ388M5.3) (MaxLight 405) discontinued
134087-ML405 100 µL

Sulfotransferase 4A1 (ST4A1, SULT4A1, Brain Sulfotransferase-like Protein, BRSTL1, BR-STL-1, hBR-STL, hBR-STL-1, Nervous System Sulfotransferase, NST, SULTX3, DJ388M5.3) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Ntrk1 3'UTR Lenti-reporter-Luc Vector
32253086 1.0 µg

Ntrk1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Transmembrane And Tetratricopeptide Repeat Containing 1 (TMTC1) Antibody
abx122910-01 100 µg

Transmembrane And Tetratricopeptide Repeat Containing 1 (TMTC1) Antibody

Sign In for Pricing
View Details