Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] NDUFA13/GRIM19 Rabbit pAb (APR24193N)

Product Specifications

Background

This gene encodes a subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain. The protein is required for complex I assembly and electron transfer activity. The protein binds the signal transducers and activators of transcription 3 (STAT3) transcription factor, and can function as a tumor suppressor. The human protein purified from mitochondria migrates at approximately 16 kDa. Transcripts originating from an upstream promoter and capable of expressing a protein with a longer N-terminus have been found, but their biological validity has not been determined.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] NDUFA13/GRIM19 Rabbit pAb (APR24193N) .

Synonyms

NDUFA13; B16.6; CDA016; CGI-39; GRIM-19; GRIM19

Gene ID

51079

UniProt

Q9P0J0

Cellular Locus

Matrix side, Mitochondrion inner membrane, Nucleus, Single-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 16kDa/24kDa Observed MW: 15kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51079

Uniprot URL

https://www.uniprot.org/uniprot/Q9P0J0

AA Sequence

KWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF837 (NM_138466) Human Over-expression Lysate
LC430049 20 µg

ZNF837 (NM_138466) Human Over-expression Lysate

Sign In for Pricing
View Details
RIP (RIPK1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A7]
TA800328AM 100 µL

RIP (RIPK1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A7]

Sign In for Pricing
View Details
5-Chloro-2'-deoxyuridine
TRC-C365235-1G 1 g

5-Chloro-2'-deoxyuridine

Sign In for Pricing
View Details
CNO6L (CNOT6L) Human Gene Knockout Kit (CRISPR)
KN419766 1 Kit

CNO6L (CNOT6L) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Mouse IgG, Fc Specific,  15nm
GAF-441-15 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Mouse IgG, Fc Specific, 15nm

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (C3e/2478), CF640R conjugate, 0.1mg/mL
BNC402478-500 1x 500 µL

CD3e (T-Cell Marker) (C3e/2478), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details