Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] NDUFA13/GRIM19 Rabbit pAb (APR24193N)

Product Specifications

Background

This gene encodes a subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain. The protein is required for complex I assembly and electron transfer activity. The protein binds the signal transducers and activators of transcription 3 (STAT3) transcription factor, and can function as a tumor suppressor. The human protein purified from mitochondria migrates at approximately 16 kDa. Transcripts originating from an upstream promoter and capable of expressing a protein with a longer N-terminus have been found, but their biological validity has not been determined.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] NDUFA13/GRIM19 Rabbit pAb (APR24193N) .

Synonyms

NDUFA13; B16.6; CDA016; CGI-39; GRIM-19; GRIM19

Gene ID

51079

UniProt

Q9P0J0

Cellular Locus

Matrix side, Mitochondrion inner membrane, Nucleus, Single-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 16kDa/24kDa Observed MW: 15kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51079

Uniprot URL

https://www.uniprot.org/uniprot/Q9P0J0

AA Sequence

KWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2',4',6'-Trihydroxyacetophenone Monohydrate
TRC-T888025-100MG 100 mg

2',4',6'-Trihydroxyacetophenone Monohydrate

Sign In for Pricing
View Details
1-Ethoxy-2-ethylbenzene
TRC-E141040-1G 1 g

1-Ethoxy-2-ethylbenzene

Sign In for Pricing
View Details
Benzethidine Hydrobromide (1.0mg/ml in Acetonitrile)
TRC-KIT3125-5X1ML 5x 1 mL

Benzethidine Hydrobromide (1.0mg/ml in Acetonitrile)

Sign In for Pricing
View Details
Human LSMD1 (NAA38) activation kit by CRISPRa
GA113510 1 Kit

Human LSMD1 (NAA38) activation kit by CRISPRa

Sign In for Pricing
View Details
S-Phenyl Benzenethiosulfonate
TRC-P319595-5G 5 g

S-Phenyl Benzenethiosulfonate

Sign In for Pricing
View Details
Superoxide Dismutase 3 Recombinant Rabbit Monoclonal Antibody [JE31-84]
HA721408 100 µL

Superoxide Dismutase 3 Recombinant Rabbit Monoclonal Antibody [JE31-84]

Sign In for Pricing
View Details