Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLK1 Rabbit pAb (APR24191N)

Product Specifications

Background

Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. This protein is functionally conserved in its capacity to release the vasoactive peptide, Lys-bradykinin, from low molecular weight kininogen.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality KLK1 Rabbit pAb (APR24191N) .

Synonyms

KLK1; KLKR; Klk6; hK1

Gene ID

3816

UniProt

P06870

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 23kDa/28kDa Observed MW: 22kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3816

Uniprot URL

https://www.uniprot.org/uniprot/P06870

AA Sequence

IVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

LOC400987 Human shRNA Plasmid Kit (Locus ID 400987)
TR308105 1 Kit

LOC400987 Human shRNA Plasmid Kit (Locus ID 400987)

Ask
View Details
DMAP1 (NM_001034024) Human Untagged Clone
SC324379 10 µg

DMAP1 (NM_001034024) Human Untagged Clone

Ask
View Details
COP (CARD16, Caspase Recruitment Domain-containing Protein 16, CARD Only Domain-containing Protein 1, Caspase-1 Inhibitor COP, Pseudo Interleukin-1 beta Converting Enzyme, Pseudo-ICE, COP1) APC
MBS6136008-01 0.1 mL

COP (CARD16, Caspase Recruitment Domain-containing Protein 16, CARD Only Domain-containing Protein 1, Caspase-1 Inhibitor COP, Pseudo Interleukin-1 beta Converting Enzyme, Pseudo-ICE, COP1) APC

Ask
View Details
COP (CARD16, Caspase Recruitment Domain-containing Protein 16, CARD Only Domain-containing Protein 1, Caspase-1 Inhibitor COP, Pseudo Interleukin-1 beta Converting Enzyme, Pseudo-ICE, COP1) APC
MBS6136008-02 5x 0.1 mL

COP (CARD16, Caspase Recruitment Domain-containing Protein 16, CARD Only Domain-containing Protein 1, Caspase-1 Inhibitor COP, Pseudo Interleukin-1 beta Converting Enzyme, Pseudo-ICE, COP1) APC

Ask
View Details
MAPKAPK3 Protein (N-GST, Human)
P521417 100 µg

MAPKAPK3 Protein (N-GST, Human)

Ask
View Details
PSMB5 (LMPX, MB1, X, Proteasome Subunit beta type-5, Macropain epsilon Chain, Multicatalytic Endopeptidase Complex epsilon Chain, Proteasome Chain 6, Proteasome epsilon Chain, Proteasome Subunit MB1, Proteasome Subunit X, MGC104214)
131955 50 µg

PSMB5 (LMPX, MB1, X, Proteasome Subunit beta type-5, Macropain epsilon Chain, Multicatalytic Endopeptidase Complex epsilon Chain, Proteasome Chain 6, Proteasome epsilon Chain, Proteasome Subunit MB1, Proteasome Subunit X, MGC104214)

Ask
View Details