Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] DNA Ligase IV Rabbit pAb (APR24179N)

Product Specifications

Background

The protein encoded by this gene is a DNA ligase that joins single-strand breaks in a double-stranded polydeoxynucleotide in an ATP-dependent reaction. This protein is essential for V (D) J recombination and DNA double-strand break (DSB) repair through nonhomologous end joining (NHEJ) . This protein forms a complex with the X-ray repair cross complementing protein 4 (XRCC4), and further interacts with the DNA-dependent protein kinase (DNA-PK) . Both XRCC4 and DNA-PK are known to be required for NHEJ. The crystal structure of the complex formed by this protein and XRCC4 has been resolved. Defects in this gene are the cause of LIG4 syndrome. Alternatively spliced transcript variants encoding the same protein have been observed.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] DNA Ligase IV Rabbit pAb (APR24179N) .

Synonyms

LIG4; LIG4S

Gene ID

3981

UniProt

P49917

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000 IF 1:10 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 103kDa Observed MW: 100kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3981

Uniprot URL

https://www.uniprot.org/uniprot/P49917

AA Sequence

SKHLYIGGDDEPQEKKRKAAPKMKKVIGIIEHLKAPNLTNVNKISNIFEDVEFCVMSGTDSQPKPDLENRIAEFGGYIVQNPGPDTYCVIAGSENIRVKNIILSNKHDVVKPAWLLECFKTKSFVPWQPRFMIHMCPSTKEHFAREYDCYGDSYFIDTDLNQLKEVFSGIKNSNEQTPEEMASLIADLEYRYSWDCSPLSMFRRHTVYLDSYAVINDLSTKNEGTRLAIKALELRFHGAKVVSCLAEGVSHVIIGEDHSRVADFKAFRRTFKRKFKILKESWVTDSIDKCELQEENQYLI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IP10 (CXCL10, Chemokine (C-X-C motif) ligand 10)
350692 100 µg

IP10 (CXCL10, Chemokine (C-X-C motif) ligand 10)

Sign In for Pricing
View Details
Rat A Disintegrin And Metalloproteinase With Thrombospondin 1 (ADAMTS1) ELISA Kit
RD-ADAMTS1-Ra-96Tests 96 Tests

Rat A Disintegrin And Metalloproteinase With Thrombospondin 1 (ADAMTS1) ELISA Kit

Sign In for Pricing
View Details
C-Myc Binding Protein (MYCBP) Magnetic Fluorescence Assay Kit
MBS2160835-01 96 Tests

C-Myc Binding Protein (MYCBP) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
C-Myc Binding Protein (MYCBP) Magnetic Fluorescence Assay Kit
MBS2160835-02 5x 96 Tests

C-Myc Binding Protein (MYCBP) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
C-Myc Binding Protein (MYCBP) Magnetic Fluorescence Assay Kit
MBS2160835-03 10x 96 Tests

C-Myc Binding Protein (MYCBP) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
MIRacle™ hsa-miR-431-3p miRNA Agomir/Antagomir
AM2403 2 OD, 4 OD, 50 OD

MIRacle™ hsa-miR-431-3p miRNA Agomir/Antagomir

Sign In for Pricing
View Details