Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GABRA2 Rabbit pAb (APR24167N)

Product Specifications

Background

GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GABRA2 Rabbit pAb (APR24167N) .

Synonyms

GABRA2

Gene ID

2555

UniProt

P47869

Cellular Locus

Cell junction, Cell membrane, Multi-pass membrane protein, postsynaptic cell membrane, synapse

Applications

WB (mouse brain, Rattus norvegicus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 51kDa/52kDa Observed MW: 50kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2555

Uniprot URL

https://www.uniprot.org/uniprot/P47869

AA Sequence

ARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKSVVNDKKKEKASVMIQNNAYAVAVANYAPNLSKDPVLSTISKSATTPEPNKKP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal ZNF230 antibody - N-terminal region
APR00673G 0.05mg

Polyclonal ZNF230 antibody - N-terminal region

Sign In for Pricing
View Details
TFF2 Recombinant Antibody, Cy7 Conjugated
bsm-62401R-Cy7 100 µL

TFF2 Recombinant Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Mouse Olfr1221 (NM_146902) AAV Particle
MR215563A1V 250 µL

Mouse Olfr1221 (NM_146902) AAV Particle

Sign In for Pricing
View Details
Kcnab1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3657205 3x 1.0 µg

Kcnab1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
LONRF1 Antibody
A54584-100UG 100 µg

LONRF1 Antibody

Sign In for Pricing
View Details
SPRED2 Human shRNA Lentiviral Particle (Locus ID 200734)
TL307826V 500 µL Each

SPRED2 Human shRNA Lentiviral Particle (Locus ID 200734)

Sign In for Pricing
View Details