Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GABRA2 Rabbit pAb (APR24167N)

Product Specifications

Background

GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GABRA2 Rabbit pAb (APR24167N) .

Synonyms

GABRA2

Gene ID

2555

UniProt

P47869

Cellular Locus

Cell junction, Cell membrane, Multi-pass membrane protein, postsynaptic cell membrane, synapse

Applications

WB (mouse brain, Rattus norvegicus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 51kDa/52kDa Observed MW: 50kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2555

Uniprot URL

https://www.uniprot.org/uniprot/P47869

AA Sequence

ARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKSVVNDKKKEKASVMIQNNAYAVAVANYAPNLSKDPVLSTISKSATTPEPNKKP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GDF7 (Growth Differentiation Factor 7, BMP12)
246545 100 µg

GDF7 (Growth Differentiation Factor 7, BMP12)

Sign In for Pricing
View Details
Anti-Cortisol/CRT Monoclonal Antibody (1A483)
MGK61202 100 μg

Anti-Cortisol/CRT Monoclonal Antibody (1A483)

Sign In for Pricing
View Details
Bovine Aggrecan core protein, ACAN ELISA Kit
MBS9339551-01 48 Well

Bovine Aggrecan core protein, ACAN ELISA Kit

Sign In for Pricing
View Details
Bovine Aggrecan core protein, ACAN ELISA Kit
MBS9339551-02 96 Well

Bovine Aggrecan core protein, ACAN ELISA Kit

Sign In for Pricing
View Details
Bovine Aggrecan core protein, ACAN ELISA Kit
MBS9339551-03 5x 96 Well

Bovine Aggrecan core protein, ACAN ELISA Kit

Sign In for Pricing
View Details
Bovine Aggrecan core protein, ACAN ELISA Kit
MBS9339551-04 10x 96 Well

Bovine Aggrecan core protein, ACAN ELISA Kit

Sign In for Pricing
View Details