Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] PSME3 Rabbit pAb (APR24162N)

Product Specifications

Background

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the gamma subunit of the 11S regulator. Six gamma subunits combine to form a homohexameric ring. Alternate splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] PSME3 Rabbit pAb (APR24160N1) .

Synonyms

PSME3; HEL-S-283; Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA

Gene ID

10197

UniProt

P61289

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:1000 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 29kDa/30kDa Observed MW: 35kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10197

Uniprot URL

https://www.uniprot.org/uniprot/P61289

AA Sequence

KVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Cystatin E/M/CST6 Antibody
NBP1-69005 100 µL

Rabbit Polyclonal Cystatin E/M/CST6 Antibody

Sign In for Pricing
View Details
pDRIVE5SEAP-hCEA
pdrive5s-hcea 20 µg

pDRIVE5SEAP-hCEA

Sign In for Pricing
View Details
Porcine Protein KIAA0317 (KIAA0317) ELISA Kit
MBS9943598-01 48 Well

Porcine Protein KIAA0317 (KIAA0317) ELISA Kit

Sign In for Pricing
View Details
Porcine Protein KIAA0317 (KIAA0317) ELISA Kit
MBS9943598-02 96 Well

Porcine Protein KIAA0317 (KIAA0317) ELISA Kit

Sign In for Pricing
View Details
Porcine Protein KIAA0317 (KIAA0317) ELISA Kit
MBS9943598-03 5x 96 Well

Porcine Protein KIAA0317 (KIAA0317) ELISA Kit

Sign In for Pricing
View Details
Porcine Protein KIAA0317 (KIAA0317) ELISA Kit
MBS9943598-04 10x 96 Well

Porcine Protein KIAA0317 (KIAA0317) ELISA Kit

Sign In for Pricing
View Details