Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] EDN1 Rabbit pAb (APR24151N)

Product Specifications

Background

This gene encodes a preproprotein that is proteolytically processed to generate a secreted peptide that belongs to the endothelin/sarafotoxin family. This peptide is a potent vasoconstrictor and its cognate receptors are therapeutic targets in the treatment of pulmonary arterial hypertension. Aberrant expression of this gene may promote tumorigenesis. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] EDN1 Rabbit pAb (APR24151N) .

Synonyms

EDN1; ARCND3; ET1; HDLCQ7; PPET1; QME; endothelin-1

Gene ID

1906

UniProt

P05305

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 24kDa Observed MW: 24kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1906

Uniprot URL

https://www.uniprot.org/uniprot/P05305

AA Sequence

APETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGKPSRERYVTHNRAHW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp551 Mouse Gene Knockout Kit (CRISPR)
KN519877 1 Kit

Zfp551 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TRMT5 (NM_020810) Human Recombinant Protein
TP760603 50 µg

TRMT5 (NM_020810) Human Recombinant Protein

Sign In for Pricing
View Details
alpha-Hyodeoxycholic Acid
TRC-H998100-5MG 5 mg

alpha-Hyodeoxycholic Acid

Sign In for Pricing
View Details
ReadiCleave™ XFD488 AML-NHS ester
7008-AAT 1 mg

ReadiCleave™ XFD488 AML-NHS ester

Sign In for Pricing
View Details
CTNNA2 (NM_004389) Human Recombinant Protein
TP308731 20 µg

CTNNA2 (NM_004389) Human Recombinant Protein

Sign In for Pricing
View Details
Pit1 (POU1F1) (NM_000306) Human Over-expression Lysate
LC424805 20 µg

Pit1 (POU1F1) (NM_000306) Human Over-expression Lysate

Sign In for Pricing
View Details