Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZC3H12D Rabbit pAb (APR24067N)

Product Specifications

Background

May regulate cell growth likely by suppressing RB1 phosphorylation. May function as RNase and regulate the levels of target RNA species (Potential. In association with ZC3H12A enhances the degradation of interleukin IL-6 mRNA level in activated macrophages. Serve as a tumor suppressor in certain leukemia cells. Overexpression inhibits the G1 to S phase progression through suppression of RB1 phosphorylation.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ZC3H12D Rabbit pAb (APR24067N) .

Synonyms

C6orf95; MCPIP4; TFL; dJ281H8.1; p34; ZC3H12D

Gene ID

340152

UniProt

A2A288

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 25kDa/36kDa/58kDa Observed MW: 70kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=340152

Uniprot URL

https://www.uniprot.org/uniprot/A2A288

AA Sequence

QHVLAELERQAVLVYTPSRKVHGKRLVCYDDRYIVKVAYEQDGVIVSNDNYRDLQSENPEWKWFIEQRLLMFSFVNDRFMP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mcm3ap sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4519002 1.0 µg DNA

Mcm3ap sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
TOMM40L (Mitochondrial import Receptor Subunit TOM40B, Protein TOMM40-like, TOMM40L, TOMM40B) (MaxLight 550) discontinued
302801-ML550 100 µL

TOMM40L (Mitochondrial import Receptor Subunit TOM40B, Protein TOMM40-like, TOMM40L, TOMM40B) (MaxLight 550) discontinued

Sign In for Pricing
View Details
ABflo® 700 Rabbit anti-Human EGFR mAb
A26810-01 50 Tests

ABflo® 700 Rabbit anti-Human EGFR mAb

Sign In for Pricing
View Details
ABflo® 700 Rabbit anti-Human EGFR mAb
A26810-02 100 Tests

ABflo® 700 Rabbit anti-Human EGFR mAb

Sign In for Pricing
View Details
ABflo® 700 Rabbit anti-Human EGFR mAb
A26810-03 200 Tests

ABflo® 700 Rabbit anti-Human EGFR mAb

Sign In for Pricing
View Details
ABflo® 700 Rabbit anti-Human EGFR mAb
A26810-04 500 Tests

ABflo® 700 Rabbit anti-Human EGFR mAb

Sign In for Pricing
View Details