Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCTN1 Rabbit pAb (APR24031N)

Product Specifications

Background

This gene encodes the largest subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. Dynactin is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit interacts with dynein intermediate chain by its domains directly binding to dynein and binds to microtubules via a highly conserved glycine-rich cytoskeleton-associated protein (CAP-Gly) domain in its N-terminus. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms. Mutations in this gene cause distal hereditary motor neuronopathy type VIIB (HMN7B) which is also known as distal spinal and bulbar muscular atrophy (dSBMA) .

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DCTN1 Rabbit pAb (APR24031N) .

Synonyms

DCTN1; DAP-150; DP-150; P135

Gene ID

1639

UniProt

Q14203

Cellular Locus

Cytoplasm, cytoskeleton

Dilution

WB 1:500 - 1:2000 IF 1:20 - 1:100 IP 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 126kDa/127kDa/136kDa/138kDa/140kDa/141kDa Observed MW: 150kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1639

Uniprot URL

https://www.uniprot.org/uniprot/Q14203

AA Sequence

PGLVKDSPLLLQQISAMRLHISQLQHENSILKGAQMKASLASLPPLHVAKLSHEGPGSELPAGALYRKTSQLLETLNQLSTHTHVVDITRTSPAAKSPSAQLMEQVAQLKSLSDTVEKLKDEVLKETVSQRPGATVPTDFATFPSSAFLRAKEEQQDDTVYMGKVTFSCAAGFGQRHRLVLTQEQLHQLHSRLIS

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

JIK, Control Peptide (DPK, JIK, KDS, MAP3K18, Serine/Threonine-protein Kinase TAO3, Cutaneous T-cell Lymphoma-associated Antigen HD-CL-09, Dendritic Cell-derived Protein Kinase, JNK/SAPK-inhibitory Kinase, Jun Kinase-inhibitory Kinase, Kinase from Chicken Homolog A, Thousand and One Amino Acid Protein 3, DKFZp666H245, FLJ31808)
148099 100 µg

JIK, Control Peptide (DPK, JIK, KDS, MAP3K18, Serine/Threonine-protein Kinase TAO3, Cutaneous T-cell Lymphoma-associated Antigen HD-CL-09, Dendritic Cell-derived Protein Kinase, JNK/SAPK-inhibitory Kinase, Jun Kinase-inhibitory Kinase, Kinase from Chicken Homolog A, Thousand and One Amino Acid Protein 3, DKFZp666H245, FLJ31808)

Ask
View Details
Anti-Phospho-CHEK2 (Ser379) Polyclonal Antibody
MF-0084422-01 50 µL

Anti-Phospho-CHEK2 (Ser379) Polyclonal Antibody

Ask
View Details
Anti-Phospho-CHEK2 (Ser379) Polyclonal Antibody
MF-0084422-02 100 µL

Anti-Phospho-CHEK2 (Ser379) Polyclonal Antibody

Ask
View Details
Lentiviral mouse Zfp641 shRNA (UAS) - Lentiviral mouse Zfp641 shRNA (UAS) (100)
GTR15250734 1 Vial

Lentiviral mouse Zfp641 shRNA (UAS) - Lentiviral mouse Zfp641 shRNA (UAS) (100)

Ask
View Details
Cavy Ovalbumin Specific Immunoglobulin A (OVA-SIgA) ELISA Kit
MBS9924835 Inquire

Cavy Ovalbumin Specific Immunoglobulin A (OVA-SIgA) ELISA Kit

Ask
View Details
Human Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3 (HCN3) ELISA Kit
MBS282244-01 48 Tests

Human Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3 (HCN3) ELISA Kit

Ask
View Details