Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM3D Rabbit pAb (APR24024N)

Product Specifications

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FAM3D Rabbit pAb (APR24024N) .

Synonyms

EF7; OIT1; FAM3D

Gene ID

131177

UniProt

Q96BQ1

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 25kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=131177

Uniprot URL

https://www.uniprot.org/uniprot/Q96BQ1

AA Sequence

RSYMSFSMKTIRLPRWLAASPTKEIQVKKYKCGLIKPCPANYFAFKICSGAANVVGPTMCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFDMYSGDVMHLVKFLKEIPGGALVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVFIGAKDLRGKSPFEQFLKNSPDTN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFAF1 Human qPCR Primer Pair (NM_016013)
HP211913 200 Reactions

NDUFAF1 Human qPCR Primer Pair (NM_016013)

Sign In for Pricing
View Details
Hsp90 beta (HSP90AB1, 90kd Heat Shock Protein beta HSP90 beta, Heat Shock 84kD, Heat Shock 90kD Protein 1, beta, Heat Shock 90kD Protein 1 beta, Heat Shock Protein 90kD alpha (cytosolic) Class B Member 1, Heat Shock Protein beta, Heat Shock Protein HSP 90 beta, Heat Shock Protein HSP 90-beta, HS90B_HUMAN, HSP 84, HSP 90, HSP 90 b, HSP 90b, HSP84, HSP90 BETA, Hsp90ab1, SP90B, HSPC2, HSPCB)
381631 100 µL

Hsp90 beta (HSP90AB1, 90kd Heat Shock Protein beta HSP90 beta, Heat Shock 84kD, Heat Shock 90kD Protein 1, beta, Heat Shock 90kD Protein 1 beta, Heat Shock Protein 90kD alpha (cytosolic) Class B Member 1, Heat Shock Protein beta, Heat Shock Protein HSP 90 beta, Heat Shock Protein HSP 90-beta, HS90B_HUMAN, HSP 84, HSP 90, HSP 90 b, HSP 90b, HSP84, HSP90 BETA, Hsp90ab1, SP90B, HSPC2, HSPCB)

Sign In for Pricing
View Details
Recombinant Brucella suis biovar 1 Flagellar M-ring protein FliF (fliF), partial
MBS7092947 Inquire

Recombinant Brucella suis biovar 1 Flagellar M-ring protein FliF (fliF), partial

Sign In for Pricing
View Details
Human cysteinyl aspartate specific proteinases 8, Caspase-8 ELISA KIT
E2171Hu-01 48 Well

Human cysteinyl aspartate specific proteinases 8, Caspase-8 ELISA KIT

Sign In for Pricing
View Details
Human cysteinyl aspartate specific proteinases 8, Caspase-8 ELISA KIT
E2171Hu-02 96 Well

Human cysteinyl aspartate specific proteinases 8, Caspase-8 ELISA KIT

Sign In for Pricing
View Details
Human cysteinyl aspartate specific proteinases 8, Caspase-8 ELISA KIT
E2171Hu-03 5x 96 Tests

Human cysteinyl aspartate specific proteinases 8, Caspase-8 ELISA KIT

Sign In for Pricing
View Details