Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H2AFV Rabbit pAb (APR24014N)

Product Specifications

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4) . The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent histone that is a member of the histone H2A family. Several transcript variants encoding different isoforms, have been identified for this gene. [provided by RefSeq, Oct 2015]

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality H2AFV Rabbit pAb (APR24014N) .

Synonyms

H2A.Z-2; H2AV; H2AFV

Gene ID

94239

UniProt

Q71UI9

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 14kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=94239

Uniprot URL

https://www.uniprot.org/uniprot/Q71UI9

AA Sequence

MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse S100 calcium binding protein A7 (S100A7) ELISA Kit
CK-bio-16894-01 48 Tests

Mouse S100 calcium binding protein A7 (S100A7) ELISA Kit

Sign In for Pricing
View Details
Mouse S100 calcium binding protein A7 (S100A7) ELISA Kit
CK-bio-16894-02 96 Tests

Mouse S100 calcium binding protein A7 (S100A7) ELISA Kit

Sign In for Pricing
View Details
Mouse S100 calcium binding protein A7 (S100A7) ELISA Kit
CK-bio-16894-03 5x 96 Tests

Mouse S100 calcium binding protein A7 (S100A7) ELISA Kit

Sign In for Pricing
View Details
Mouse S100 calcium binding protein A7 (S100A7) ELISA Kit
CK-bio-16894-04 10x 96 Tests

Mouse S100 calcium binding protein A7 (S100A7) ELISA Kit

Sign In for Pricing
View Details
SEMA3C Rabbit Polyclonal Antibody
E28PT4233 100 µL

SEMA3C Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human SHMT2 shRNA (UAS) - Lentiviral human SHMT2 shRNA (UAS) plasmid
GTR15345502 1 Vial

Lentiviral human SHMT2 shRNA (UAS) - Lentiviral human SHMT2 shRNA (UAS) plasmid

Sign In for Pricing
View Details