Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIGM Rabbit pAb (APR24013N)

Product Specifications

Background

This gene encodes a transmembrane protein that is located in the endoplasmic reticulum and is involved in GPI-anchor biosynthesis. The glycosylphosphatidylinositol (GPI) -anchor is a glycolipid which contains three mannose molecules in its core backbone. The GPI-anchor is found on many blood cells and serves to anchor proteins to the cell surface. This gene encodes a mannosyltransferase, GPI-MT-I, that transfers the first mannose to GPI on the lumenal side of the endoplasmic reticulum. [provided by RefSeq, Jul 2008]

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PIGM Rabbit pAb (APR24013N) .

Synonyms

GPI-MT-I; PIGM

Gene ID

93183

UniProt

Q9H3S5

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 49kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=93183

Uniprot URL

https://www.uniprot.org/uniprot/Q9H3S5

AA Sequence

YGVFQDRTLHVRYTDIDYQVFTDAARFVTEGRSPYLRATYRYTPLLGWLLTPNIYLSELFGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD107a rabbit pAb Antibody
orb766865-01 50 μL

CD107a rabbit pAb Antibody

Sign In for Pricing
View Details
CD107a rabbit pAb Antibody
orb766865-02 100 µL

CD107a rabbit pAb Antibody

Sign In for Pricing
View Details
Human PALLD ELISA Kit (Ready to Use)
orb551821-01 48 Tests

Human PALLD ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Human PALLD ELISA Kit (Ready to Use)
orb551821-02 96 Tests

Human PALLD ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
WWTR1 Rabbit Polyclonal Antibody (FITC)
orb3127833 100 µg

WWTR1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Dog ELA1 (Elastase 1, Pancreatic) ELISA Kit
EK250530 96 Well

Dog ELA1 (Elastase 1, Pancreatic) ELISA Kit

Sign In for Pricing
View Details