Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAF1 Rabbit pAb (APR24011N)

Product Specifications

Background

RNA-binding protein required for the maturation of box H/ACA snoRNPs complex and ribosome biogenesis. During assembly of the H/ACA snoRNPs complex, it associates with the complex and disappears during maturation of the complex and is replaced by NOLA1/GAR1 to yield mature H/ACA snoRNPs complex. Probably competes with NOLA1/GAR1 for binding with DKC1/NOLA4.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NAF1 Rabbit pAb (APR24011N) .

Synonyms

NAF1

Gene ID

92345

UniProt

Q96HR8

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 62-70kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=92345

Uniprot URL

https://www.uniprot.org/uniprot/Q96HR8

AA Sequence

PPVLSDGDDDLQIEKENKNFPLKTKDELLLNELPSVEELTIILPEDIELKPLGMVSSIIEQLVIIESMTNLPPVNEETVIFKSDRQAAGKIFEIFGPVAHPFYVLRFNSSDHIESKGIKIKETMYFAPSMKDFTQYIFTEKLKQDKGSDASWKNDQEPPPEALDFSDDEKEKEAKQRKKSQIQGRKKLKSEFNEPGEDFTEVHQNWNAHSSASEHAKGYRNREFTRGFSRARYPRSCHGRPPPQHFYNSEH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Doner Horse Serum
F0605-050 500 mL

Doner Horse Serum

Sign In for Pricing
View Details
Rabbit anti-Bordetella pertussis Serotype 2 fimbriasubunit polyclonal Antibody, FITC
MBS1490534-01 0.05 mg

Rabbit anti-Bordetella pertussis Serotype 2 fimbriasubunit polyclonal Antibody, FITC

Sign In for Pricing
View Details
Rabbit anti-Bordetella pertussis Serotype 2 fimbriasubunit polyclonal Antibody, FITC
MBS1490534-02 0.1 mg

Rabbit anti-Bordetella pertussis Serotype 2 fimbriasubunit polyclonal Antibody, FITC

Sign In for Pricing
View Details
Rabbit anti-Bordetella pertussis Serotype 2 fimbriasubunit polyclonal Antibody, FITC
MBS1490534-03 5x 0.1 mg

Rabbit anti-Bordetella pertussis Serotype 2 fimbriasubunit polyclonal Antibody, FITC

Sign In for Pricing
View Details
Human ZC4H2 Knockout HEK293T cell line
GTR15402902 1 Vial

Human ZC4H2 Knockout HEK293T cell line

Sign In for Pricing
View Details
PLCL2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1663708 1.0 µg DNA

PLCL2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details