Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

N4BP2L1 Rabbit pAb (APR24005N)

Product Specifications

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality N4BP2L1 Rabbit pAb (APR24005N) .

Synonyms

CG018; N4BP2L1

Gene ID

90634

UniProt

Q5TBK1

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 29kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=90634

Uniprot URL

https://www.uniprot.org/uniprot/Q5TBK1

AA Sequence

FRKHLYLLRGLPGSGKTTLARQLQHDFPRALIFSTDDFFFREDGAYEFNPDFLEEAHEWNQKRARKAMRNGISPIIIDNTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIM and SH3 domain protein 1 LASP1 Rabbit Polyclonal Antibody (PE)
orb2577064 100 µg

LIM and SH3 domain protein 1 LASP1 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
LentimiRa-Off-mmu-miR-7083-3p Vector
mm31712 500 ng

LentimiRa-Off-mmu-miR-7083-3p Vector

Sign In for Pricing
View Details
Human Kruppel Like Factor 5, Intestinal ELISA Kit
MBS069360-01 48 Well

Human Kruppel Like Factor 5, Intestinal ELISA Kit

Sign In for Pricing
View Details
Human Kruppel Like Factor 5, Intestinal ELISA Kit
MBS069360-02 96 Well

Human Kruppel Like Factor 5, Intestinal ELISA Kit

Sign In for Pricing
View Details
Human Kruppel Like Factor 5, Intestinal ELISA Kit
MBS069360-03 5x 96 Well

Human Kruppel Like Factor 5, Intestinal ELISA Kit

Sign In for Pricing
View Details
Human Kruppel Like Factor 5, Intestinal ELISA Kit
MBS069360-04 10x 96 Well

Human Kruppel Like Factor 5, Intestinal ELISA Kit

Sign In for Pricing
View Details