Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tubulin beta-1 chain Rabbit pAb (APR23986N)

Product Specifications

Background

This gene encodes a member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is specifically expressed in platelets and megakaryocytes and may be involved in proplatelet production and platelet release. A mutations in this gene is associated with autosomal dominant macrothrombocytopenia. Two pseudogenes of this gene are found on chromosome Y.[provided by RefSeq, Jul 2010]

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Tubulin beta-1 chain Rabbit pAb (APR23986N) .

Synonyms

TUBB1

Gene ID

81027

UniProt

Q9H4B7

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 50kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=81027

Uniprot URL

https://www.uniprot.org/uniprot/Q9H4B7

AA Sequence

SMAATFIGNNTAIQEIFNRVSEHFSAMFKRKAFVHWYTSEGMDINEFGEAENNIHDLVSEYQQFQDAKAVLEEDEEVTEEAEMEPEDKGH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C15orf24 (EMC7) Human shRNA Lentiviral Particle (Locus ID 56851)
TL306155V 500 µL Each

C15orf24 (EMC7) Human shRNA Lentiviral Particle (Locus ID 56851)

Sign In for Pricing
View Details
CD19 (B Lymphocyte Antigen CD19, Differentiation Antigen CD19, B4, CVID3)
367038-01 100 µg

CD19 (B Lymphocyte Antigen CD19, Differentiation Antigen CD19, B4, CVID3)

Sign In for Pricing
View Details
CD19 (B Lymphocyte Antigen CD19, Differentiation Antigen CD19, B4, CVID3)
367038-02 500 µg

CD19 (B Lymphocyte Antigen CD19, Differentiation Antigen CD19, B4, CVID3)

Sign In for Pricing
View Details
AP1M1, ID (AP1M1, CLTNM, AP-1 complex subunit mu-1, AP-mu chain family member mu1A, Adaptor protein complex AP-1 mu-1 subunit, Adaptor-related protein complex 1 mu-1 subunit, Clathrin assembly protein complex 1 medium chain 1, Clathrin coat assembly protein AP47, Clathrin coat-associated protein AP47, Golgi adaptor HA1/AP1 adaptin mu-1 subunit, Mu-adaptin 1, Mu1A-adaptin) (AP) discontinued
031938-AP 200 µL

AP1M1, ID (AP1M1, CLTNM, AP-1 complex subunit mu-1, AP-mu chain family member mu1A, Adaptor protein complex AP-1 mu-1 subunit, Adaptor-related protein complex 1 mu-1 subunit, Clathrin assembly protein complex 1 medium chain 1, Clathrin coat assembly protein AP47, Clathrin coat-associated protein AP47, Golgi adaptor HA1/AP1 adaptin mu-1 subunit, Mu-adaptin 1, Mu1A-adaptin) (AP) discontinued

Sign In for Pricing
View Details
SKP1 (S-phase Kinase-associated Protein 1, Cyclin-A/CDK2-associated Protein p19, Organ of Corti Protein 2, OCP-2, Organ of Corti Protein II, OCP-II, RNA Polymerase II Elongation Factor-like Protein, SIII, Transcription Elongation Factor B, p19A, p19skp1, EMC19, OCP2, SKP1A, TCEB1L, MGC34403) (MaxLight 405) discontinued
133380-ML405 100 µL

SKP1 (S-phase Kinase-associated Protein 1, Cyclin-A/CDK2-associated Protein p19, Organ of Corti Protein 2, OCP-2, Organ of Corti Protein II, OCP-II, RNA Polymerase II Elongation Factor-like Protein, SIII, Transcription Elongation Factor B, p19A, p19skp1, EMC19, OCP2, SKP1A, TCEB1L, MGC34403) (MaxLight 405) discontinued

Sign In for Pricing
View Details
ATF5 Recombinant Antibody, RBITC Conjugated
bsm-61324R-RBITC-01 20 µL

ATF5 Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details