Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tubulin beta-1 chain Rabbit pAb (APR23986N)

Product Specifications

Background

This gene encodes a member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is specifically expressed in platelets and megakaryocytes and may be involved in proplatelet production and platelet release. A mutations in this gene is associated with autosomal dominant macrothrombocytopenia. Two pseudogenes of this gene are found on chromosome Y.[provided by RefSeq, Jul 2010]

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Tubulin beta-1 chain Rabbit pAb (APR23986N) .

Synonyms

TUBB1

Gene ID

81027

UniProt

Q9H4B7

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 50kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=81027

Uniprot URL

https://www.uniprot.org/uniprot/Q9H4B7

AA Sequence

SMAATFIGNNTAIQEIFNRVSEHFSAMFKRKAFVHWYTSEGMDINEFGEAENNIHDLVSEYQQFQDAKAVLEEDEEVTEEAEMEPEDKGH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bovine Rantes
P0440-01 50 µg

Recombinant Bovine Rantes

Sign In for Pricing
View Details
Recombinant Bovine Rantes
P0440-02 200 µg

Recombinant Bovine Rantes

Sign In for Pricing
View Details
Recombinant Bovine Rantes
P0440-03 1 mg

Recombinant Bovine Rantes

Sign In for Pricing
View Details
Lentiviral human GDAP1L1 shRNA (UAS) - Lentiviral human GDAP1L1 shRNA (UAS, iRFP) plasmid
GTR15160024 1 Vial

Lentiviral human GDAP1L1 shRNA (UAS) - Lentiviral human GDAP1L1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
AGPAT1 Protein Vector (Rat) (pPM-C-His)
PV252705 500 ng

AGPAT1 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Rabbit Monoclonal Leptin/OB Antibody (002) [Alexa Fluor 488]
NBP2-89345AF488 0.1 mL

Rabbit Monoclonal Leptin/OB Antibody (002) [Alexa Fluor 488]

Sign In for Pricing
View Details