Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tubulin beta-1 chain Rabbit pAb (APR23986N)

Product Specifications

Background

This gene encodes a member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is specifically expressed in platelets and megakaryocytes and may be involved in proplatelet production and platelet release. A mutations in this gene is associated with autosomal dominant macrothrombocytopenia. Two pseudogenes of this gene are found on chromosome Y.[provided by RefSeq, Jul 2010]

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Tubulin beta-1 chain Rabbit pAb (APR23986N) .

Synonyms

TUBB1

Gene ID

81027

UniProt

Q9H4B7

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 50kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=81027

Uniprot URL

https://www.uniprot.org/uniprot/Q9H4B7

AA Sequence

SMAATFIGNNTAIQEIFNRVSEHFSAMFKRKAFVHWYTSEGMDINEFGEAENNIHDLVSEYQQFQDAKAVLEEDEEVTEEAEMEPEDKGH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIPPLY1 (NM_138382) Human Over-expression Lysate
LC408647 20 µg

RIPPLY1 (NM_138382) Human Over-expression Lysate

Sign In for Pricing
View Details
Human SART1 MAb (Clone 865709)
MAB8034 100 µg

Human SART1 MAb (Clone 865709)

Sign In for Pricing
View Details
Prps2 (NM_012634) Rat Tagged Lenti ORF Clone
RR204467L3 10 µg

Prps2 (NM_012634) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Guinea pig Chromogranin B (CHGB) ELISA Kit
abx357908 96 Well

Guinea pig Chromogranin B (CHGB) ELISA Kit

Sign In for Pricing
View Details
TMPPE sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2410105 3x 1.0 µg

TMPPE sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Osbpl11 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4912903 1.0 µg DNA

Osbpl11 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details