Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] SLC25A22 Rabbit pAb (APR23980N)

Product Specifications

Background

This gene encodes a mitochondrial glutamate carrier. Mutations in this gene are associated with early infantile epileptic encephalopathy. Multiple alternatively spliced variants, encoding the same protein, have been identified.[provided by RefSeq, Jul 2010]

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] SLC25A22 Rabbit pAb (APR23980N) .

Synonyms

EIEE3; GC-1; GC1; NET44; SLC25A22

Gene ID

79751

UniProt

Q9H936

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 34kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=79751

Uniprot URL

https://www.uniprot.org/uniprot/Q9H936

AA Sequence

KIQLQDAGRIAAQRKILAAQGQLSAQGGAQPSVEAPAAPRPTATQLTRDLLRSRGIAGLYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNC 80
FS27844-01 10 mg

SNC 80

Sign In for Pricing
View Details
SNC 80
FS27844-02 25 mg

SNC 80

Sign In for Pricing
View Details
FAM183BP Peptide - C-terminal region
orb2005328 100 µg

FAM183BP Peptide - C-terminal region

Sign In for Pricing
View Details
Lentiviral mouse Efcab11 shRNA (UAS) - Lentiviral mouse Efcab11 shRNA (UAS, RFP) plasmid
GTR15216373 1 Vial

Lentiviral mouse Efcab11 shRNA (UAS) - Lentiviral mouse Efcab11 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Recombinant Rat ETFB Protein, His (Fc)-Avi-tagged
ETFB-1817R 50 µg

Recombinant Rat ETFB Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Recombinant Korarchaeum cryptofilum Elongation factor 1-beta (ef1b)
MBS1216309-01 0.02 mg (E-Coli)

Recombinant Korarchaeum cryptofilum Elongation factor 1-beta (ef1b)

Sign In for Pricing
View Details