GGT1 Rabbit pAb (APR23967N)
Product Specifications
Background
The enzyme encoded by this gene is a type I gamma-glutamyltransferase that catalyzes the transfer of the glutamyl moiety of glutathione to a variety of amino acids and dipeptide acceptors. The enzyme is composed of a heavy chain and a light chain, which are derived from a single precursor protein. It is expressed in tissues involved in absorption and secretion and may contribute to the etiology of diabetes and other metabolic disorders. Multiple alternatively spliced variants have been identified. There are a number of related genes present on chromosomes 20 and 22, and putative pseudogenes for this gene on chromosomes 2, 13, and 22.
Overview
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GGT1 Rabbit pAb (APR23967N) .
Synonyms
GGT1; CD224; D22S672; D22S732; GGT; GGT 1; GTG
Gene ID
2678
UniProt
P19440
Cellular Locus
Cell membrane, Single-pass type II membrane protein
Dilution
WB 1:500 - 1:2000 IHC 1:50 - 1:200
Form
Liquid
Buffer
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Molecular Weight
Calculated MW: 24kDa/39kDa/61kDa Observed MW: 60-70kDa
Storage Conditions
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
Gene ID URL
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2678
Uniprot URL
https://www.uniprot.org/uniprot/P19440
AA Sequence
KPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITTATALAIIYNLWFGYDVKRAVEEPRLHNQLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSRKGGEPAGY
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400040-100 1x 100 µL
CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401003-500 1x 500 µL
Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680745-100 1x 100 µL
CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040050-100 1x 100 µL
IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882475-500 1x 500 µL
GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/2475), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details