Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNMD Rabbit pAb (APR23962N)

Product Specifications

Background

This gene encodes a protein that is related to chondromodulin-I, which is a cartilage-specific glycoprotein that functions to stimulate chondrocyte growth and to inhibit tube formation of endothelial cells. This protein is also an angiogenesis inhibitor. Genetic variation in this gene is associated with a risk for type 2 diabetes, central obesity and serum levels of systemic immune mediators in a body size-dependent manner. This gene is also a candidate gene for age-related macular degeneration, though a direct link has yet to be demonstrated. [provided by RefSeq, Sep 2009]

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TNMD Rabbit pAb (APR23962N) .

Synonyms

BRICD4; CHM1L; TEM; TNMD

Gene ID

64102

UniProt

Q9H2S6

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 37kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=64102

Uniprot URL

https://www.uniprot.org/uniprot/Q9H2S6

AA Sequence

SGNGTDETLEVHDFKNGYTGIYFVGLQKCFIKTQIKVIPEFSEPEEEIDENEEITTTFFEQSVIWVPAEKPIENRDFLKNSKILEICDNVTMYWIN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human LRRC18 sgRNA gene knockout kit - Lentiviral human LRRC18 sgRNA gene knockout kit (plasmid)
GTR15383759 1 Vial

Lentiviral human LRRC18 sgRNA gene knockout kit - Lentiviral human LRRC18 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Recombinant Corynebacterium Diphtheriae mutM Protein (aa 2-296)
VAng-Lsx3041-50gEcoli 50 µg (E. coli)

Recombinant Corynebacterium Diphtheriae mutM Protein (aa 2-296)

Sign In for Pricing
View Details
Cytokeratin 13 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-1717R-BF555-01 20 µL

Cytokeratin 13 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Cytokeratin 13 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-1717R-BF555-02 100 µL

Cytokeratin 13 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Rat Rec8 ELISA Kit
ELI-30116r 96 Tests

Rat Rec8 ELISA Kit

Sign In for Pricing
View Details
Nt5e-set siRNA/shRNA/RNAi Lentivector (Mouse)
32232094 4x 500 ng

Nt5e-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details