Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMAP1 Rabbit pAb (APR23960N)

Product Specifications

Background

The protein encoded by this gene is similar to the mouse stromal membrane-associated protein-1. This similarity suggests that this human gene product is also a type II membrane glycoprotein involved in the erythropoietic stimulatory activity of stromal cells. Alternate splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SMAP1 Rabbit pAb (APR23960N) .

Synonyms

SMAP-1; SMAP1

Gene ID

60682

UniProt

Q8IYB5

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 50kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=60682

Uniprot URL

https://www.uniprot.org/uniprot/Q8IYB5

AA Sequence

EPEKPAKPLTAEKLQKKDQQLEPKKSTSPKKAAEPTVDLLGLDGPAVAPVTNGNTTVPPLNDDLDIFGPMI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FUT10 Knockout A549 cell line
GTR15405415 1 Vial

Human FUT10 Knockout A549 cell line

Sign In for Pricing
View Details
Lentiviral human TEX264 sgRNA gene knockout kit - Lentiviral human TEX264 sgRNA gene knockout kit (100)
GTR15365740 1 Vial

Lentiviral human TEX264 sgRNA gene knockout kit - Lentiviral human TEX264 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Recombinant Mouse ZNF598 Protein, His (Fc)-Avi-tagged
ZNF598-10449M 50 µg

Recombinant Mouse ZNF598 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Lentiviral human SPATA18 sgRNA gene knockout kit - Lentiviral human SPATA18 sgRNA gene knockout kit (100)
GTR15382138 1 Vial

Lentiviral human SPATA18 sgRNA gene knockout kit - Lentiviral human SPATA18 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Phospho-FoxO1-S256 polyclonal antibody
orb1717505-01 50 µL

Phospho-FoxO1-S256 polyclonal antibody

Sign In for Pricing
View Details
Phospho-FoxO1-S256 polyclonal antibody
orb1717505-02 100 µL

Phospho-FoxO1-S256 polyclonal antibody

Sign In for Pricing
View Details