Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UTP6 Rabbit pAb (APR23940N)

Product Specifications

Background

Involved in nucleolar processing of pre-18S ribosomal RNA.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality UTP6 Rabbit pAb (APR23939N0) .

Synonyms

C17orf40; HCA66; UTP6

Gene ID

55813

UniProt

Q9NYH9

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 70kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55813

Uniprot URL

https://www.uniprot.org/uniprot/Q9NYH9

AA Sequence

MAEIIQERIEDRLPELEQLERIGLFSHAEIKAIIKKASDLEYKIQRRTLFKEDFINYVQYEINLLELIQRRRTRIGYSFKKDEIENSIVHRVQGVFQRASAKWKDDVQLWLSYVAFCKKWATKTRLSKVFSAMLAIHSNKPALWIMAAKWEMEDRLSSESARQLFLRALRFHPECPKLYKEYFRMELMHAEKLRKEKEEFEKASMDVENPDYSEEILKGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fish Sodium Channel Protein Type 10 Subunit Alpha (SCN10A) ELISA Kit
MBS9346144 Inquire

Fish Sodium Channel Protein Type 10 Subunit Alpha (SCN10A) ELISA Kit

Sign In for Pricing
View Details
EIF3K, CT (EIF3K, EIF3S12, Eukaryotic translation initiation factor 3 subunit K, Eukaryotic translation initiation factor 3 subunit 12, Muscle-specific gene M9 protein, PLAC-24, eIF-3 p25, eIF-3 p28) (MaxLight 750) discontinued
035007-ML750 100 µL

EIF3K, CT (EIF3K, EIF3S12, Eukaryotic translation initiation factor 3 subunit K, Eukaryotic translation initiation factor 3 subunit 12, Muscle-specific gene M9 protein, PLAC-24, eIF-3 p25, eIF-3 p28) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Profilin-1 Rat Recombinant
rAP-4572 1 Each

Profilin-1 Rat Recombinant

Sign In for Pricing
View Details
Recombinant Xanthomonas oryzae pv. oryzae Protein SlyX homolog (slyX)
MBS1485679-01 0.02 mg (E-Coli)

Recombinant Xanthomonas oryzae pv. oryzae Protein SlyX homolog (slyX)

Sign In for Pricing
View Details
Recombinant Xanthomonas oryzae pv. oryzae Protein SlyX homolog (slyX)
MBS1485679-02 0.1 mg (E-Coli)

Recombinant Xanthomonas oryzae pv. oryzae Protein SlyX homolog (slyX)

Sign In for Pricing
View Details
Recombinant Xanthomonas oryzae pv. oryzae Protein SlyX homolog (slyX)
MBS1485679-03 0.02 mg (Yeast)

Recombinant Xanthomonas oryzae pv. oryzae Protein SlyX homolog (slyX)

Sign In for Pricing
View Details