Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cyclin D2 Rabbit pAb (APR23939N)

Product Specifications

Background

The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with CDK4 or CDK6 and functions as a regulatory subunit of the complex, whose activity is required for cell cycle G1/S transition. This protein has been shown to interact with and be involved in the phosphorylation of tumor suppressor protein Rb. Knockout studies of the homologous gene in mouse suggest the essential roles of this gene in ovarian granulosa and germ cell proliferation. High level expression of this gene was observed in ovarian and testicular tumors. Mutations in this gene are associated with megalencephaly-polymicrogyria-polydactyly-hydrocephalus syndrome 3 (MPPH3) .

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Cyclin D2 Rabbit pAb (APR23939N) .

Synonyms

CCND2; KIAK0002; MPPH3; cyclin D2; Cyclin D2

Gene ID

894

UniProt

P30279

Cellular Locus

Cytoplasm, Membrane, Nucleus

Applications

WB (Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 24kDa/33kDa Observed MW: 34kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=894

Uniprot URL

https://www.uniprot.org/uniprot/P30279

AA Sequence

MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TSC22D3, ID (TSC22D3, DSIPI, GILZ, TSC22 domain family protein 3, DSIP-immunoreactive peptide, Delta sleep-inducing peptide immunoreactor, Glucocorticoid-induced leucine zipper protein, TSC-22-like protein, TSC-22-related protein) (FITC) discontinued
043356-FITC 200 µL

TSC22D3, ID (TSC22D3, DSIPI, GILZ, TSC22 domain family protein 3, DSIP-immunoreactive peptide, Delta sleep-inducing peptide immunoreactor, Glucocorticoid-induced leucine zipper protein, TSC-22-like protein, TSC-22-related protein) (FITC) discontinued

Ask
View Details
RPL23 Human Pre-designed siRNA Set A
HY-RS12175 1 Set

RPL23 Human Pre-designed siRNA Set A

Ask
View Details
Urea (Urea) ELISA Kit
CK-bio-28011-01 48 Tests

Urea (Urea) ELISA Kit

Ask
View Details
Urea (Urea) ELISA Kit
CK-bio-28011-02 96 Tests

Urea (Urea) ELISA Kit

Ask
View Details
Goat Anti-Mouse IgG (H&L) - AF568
BS21693-01 100 µL

Goat Anti-Mouse IgG (H&L) - AF568

Ask
View Details
Goat Anti-Mouse IgG (H&L) - AF568
BS21693-02 500 µL

Goat Anti-Mouse IgG (H&L) - AF568

Ask
View Details