Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLHL11 Rabbit pAb (APR23925N)

Product Specifications

Background

Component of a cullin-RING-based BCR (BTB-CUL3-RBX1 E3 ubiquitin-protein ligase complex that mediates the ubiquitination of target proteins, leading most often to their proteasomal degradation.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality KLHL11 Rabbit pAb (APR23925N) .

Synonyms

KLHL11

Gene ID

55175

UniProt

Q9NVR0

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 80kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55175

Uniprot URL

https://www.uniprot.org/uniprot/Q9NVR0

AA Sequence

ASLQVLEMESMETAAAGSAGLAAEVRGSGTVDFGPGPGISAMEASGGDPGPEAEDFECSSHCSELSWRQNEQRRQGLFCDITLCFGGAGGREFRAHRSVLAAATEYFTPLLSGQFSESRSGRVEMRKWSSEPGPEPDTVEAVIEYMYTGRIRVSTGSVHEVLELADRFLLIRLKEFCGEFLKKKLHLSNCVAIHSLAHMYTLSQLALKAADMIRRNFHKVIQDEEFYTLPFHLIRDWLSDLEITVDSEEVLFETVLKWVQRNAEERERYFEELFKLLRLSQMKPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cav2.3 Ca2+ channel Antibody
E55A14871 100 µg

Cav2.3 Ca2+ channel Antibody

Sign In for Pricing
View Details
SMYD5 (SET and MYND Domain-containing Protein 5, Retinoic Acid-induced Protein 15, RRG1, RAI15, NN8-4AG, ZMYND23) (MaxLight 405)
MBS6438348-01 0.1 mL

SMYD5 (SET and MYND Domain-containing Protein 5, Retinoic Acid-induced Protein 15, RRG1, RAI15, NN8-4AG, ZMYND23) (MaxLight 405)

Sign In for Pricing
View Details
SMYD5 (SET and MYND Domain-containing Protein 5, Retinoic Acid-induced Protein 15, RRG1, RAI15, NN8-4AG, ZMYND23) (MaxLight 405)
MBS6438348-02 5x 0.1 mL

SMYD5 (SET and MYND Domain-containing Protein 5, Retinoic Acid-induced Protein 15, RRG1, RAI15, NN8-4AG, ZMYND23) (MaxLight 405)

Sign In for Pricing
View Details
SLC35D2 Rabbit Polyclonal Antibody (Biotin)
orb2089846 100 µL

SLC35D2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Human AMY1 (Alpha-amylase 1) ELISA Kit
EH1654 96 Tests

Human AMY1 (Alpha-amylase 1) ELISA Kit

Sign In for Pricing
View Details
C1S Mouse Monoclonal Antibody [Clone 4D10]
E45M12059V-2 50 µL

C1S Mouse Monoclonal Antibody [Clone 4D10]

Sign In for Pricing
View Details