Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SETD4 Rabbit pAb (APR23916N)

Product Specifications

Background

Histone-lysine N-methyltransferase that acts as a regulator of cell proliferation, cell differentiation and inflammatory response. Regulates the inflammatory response by mediating mono- and dimethylation of 'Lys-4' of histone H3 (H3K4me1 and H3K4me2, respectively, leading to activate the transcription of proinflammatory cytokines IL6 and TNF-alpha (By similarity. Also involved in the regulation of stem cell quiescence by catalyzing the trimethylation of 'Lys-20' of histone H4 (H4K20me3, thereby promoting heterochromatin formation. Involved in proliferation, migration, paracrine and myogenic differentiation of bone marrow mesenchymal stem cells (BMSCs (By similarity.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SETD4 Rabbit pAb (APR23916N) .

Synonyms

C21orf18; C21orf27; SETD4

Gene ID

54093

UniProt

Q9NVD3

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 50kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=54093

Uniprot URL

https://www.uniprot.org/uniprot/Q9NVD3

AA Sequence

YLRPRQRECLSAEPDTCALAPYLDLLNHSPHVQVKAAFNEETHSYEIRTTSRWRKHEEVFICYGPHDNQRLFLEYGFVSVHNPHACVYVSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Anti Mouse Gr-1: FITC
MBS225657-01 0.1 mg

Rat Anti Mouse Gr-1: FITC

Sign In for Pricing
View Details
Rat Anti Mouse Gr-1: FITC
MBS225657-02 5x 0.1 mg

Rat Anti Mouse Gr-1: FITC

Sign In for Pricing
View Details
Recombinant Borrelia garinii UDP-N-acetylmuramyl-tripeptide synthetase (murE), partial
MBS1476882 Inquire

Recombinant Borrelia garinii UDP-N-acetylmuramyl-tripeptide synthetase (murE), partial

Sign In for Pricing
View Details
Recombinant Chicken Interleukin-8 (CXCL8)
AP9C643-01 1 mg

Recombinant Chicken Interleukin-8 (CXCL8)

Sign In for Pricing
View Details
Recombinant Chicken Interleukin-8 (CXCL8)
AP9C643-02 100 µg

Recombinant Chicken Interleukin-8 (CXCL8)

Sign In for Pricing
View Details
Recombinant Chicken Interleukin-8 (CXCL8)
AP9C643-03 20 µg

Recombinant Chicken Interleukin-8 (CXCL8)

Sign In for Pricing
View Details