Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STRN4 Rabbit pAb (APR23903N)

Product Specifications

Background

Binds calmodulin in a calcium dependent manner. May function as scaffolding or signaling protein.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality STRN4 Rabbit pAb (APR23903N) .

Synonyms

PPP2R6C; ZIN; zinedin; STRN4

Gene ID

29888

UniProt

Q9NRL3

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 98kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=29888

Uniprot URL

https://www.uniprot.org/uniprot/Q9NRL3

AA Sequence

SGGESLLVKQIEEQIKRNAAGKDGKERLGGSVLGQIPFLQNCEDEDSDEDDELDSVQHKKQRVKLPSKALVPEMEDEDEEDDSEDAINEFD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Multiplex Assay Kit for Transient Receptor Potential Cation Channel Subfamily M, Member 7 (TRPM7), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0030796 96 Tests

Multiplex Assay Kit for Transient Receptor Potential Cation Channel Subfamily M, Member 7 (TRPM7), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
Zfp458 Mouse shRNA Plasmid (Locus ID 238690)
TL510143 1 Kit

Zfp458 Mouse shRNA Plasmid (Locus ID 238690)

Sign In for Pricing
View Details
CNTN5 CRISPR Knock Out 293T Cell Line (Human)
16518141 1x 10^6 Cells / 1.0 mL

CNTN5 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
SPO11 Rabbit Polyclonal Antibody (Biotin)
orb2806239 100 µg

SPO11 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Ttc39a AAV siRNA Pooled Vector
48695164 1.0 µg

Ttc39a AAV siRNA Pooled Vector

Sign In for Pricing
View Details
BRG1 Antibody
MBS9613093-01 0.05 mL

BRG1 Antibody

Sign In for Pricing
View Details