Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKLE2 Rabbit pAb (APR23870N)

Product Specifications

Background

This gene encodes a member of the LEM family of inner nuclear membrane proteins. The encoded protein functions as a mitotic regulator through postmitotic formation of the nuclear envelope. Mutations in this gene cause morphology defects in the nuclear envelope and BAF hyperphosphorylation. [provided by RefSeq, Mar 2014]

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ANKLE2 Rabbit pAb (APR23870N) .

Synonyms

KIAA0692; LEMD7; Lem4; MCPH16; ANKLE2

Gene ID

23141

UniProt

Q86XL3

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 104kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=23141

Uniprot URL

https://www.uniprot.org/uniprot/Q86XL3

AA Sequence

CRYNVMHVAAKENQASICQLTLDVLENPDFMRLMYPDDDEAMLQKRIRYVVDLYLNTPDKMGYDTPLHFACKFGNADVVNVLSSHHLIVKNSRNKYDKTPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neuregulin-1 Polyclonal Antibody
E20-75319 100 µg

Neuregulin-1 Polyclonal Antibody

Sign In for Pricing
View Details
Pol II Lentiviral Activation Particles (h2)
sc-400053-LAC-2 200 µL

Pol II Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
PTPRZ1 Recombinant Protein
OPCD00406-200UG 200 µg

PTPRZ1 Recombinant Protein

Sign In for Pricing
View Details
Xkr7 ORF Vector (Rat) (pORF)
50527016 1.0 µg DNA

Xkr7 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Human Midkine Construction Kit w/Developing Reagents & Plates
RHF911CKP 960 Tests

Human Midkine Construction Kit w/Developing Reagents & Plates

Sign In for Pricing
View Details
MacConkey Medium (Economy pack)
MF012E-50PC 1 unit

MacConkey Medium (Economy pack)

Sign In for Pricing
View Details