Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKLE2 Rabbit pAb (APR23870N)

Product Specifications

Background

This gene encodes a member of the LEM family of inner nuclear membrane proteins. The encoded protein functions as a mitotic regulator through postmitotic formation of the nuclear envelope. Mutations in this gene cause morphology defects in the nuclear envelope and BAF hyperphosphorylation. [provided by RefSeq, Mar 2014]

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ANKLE2 Rabbit pAb (APR23870N) .

Synonyms

KIAA0692; LEMD7; Lem4; MCPH16; ANKLE2

Gene ID

23141

UniProt

Q86XL3

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 104kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=23141

Uniprot URL

https://www.uniprot.org/uniprot/Q86XL3

AA Sequence

CRYNVMHVAAKENQASICQLTLDVLENPDFMRLMYPDDDEAMLQKRIRYVVDLYLNTPDKMGYDTPLHFACKFGNADVVNVLSSHHLIVKNSRNKYDKTPE

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NMT2 Mouse Monoclonal Antibody [Clone ID: OTI2A5]
CF504177 100 µg

NMT2 Mouse Monoclonal Antibody [Clone ID: OTI2A5]

Ask
View Details
CD20 (CD20 Antigen, B1, B-lymphocyte Cell-surface Antigen B1, Bp35, CD20 Receptor, LEU-16, MGC3969, Membrane-spanning 4-domains Subfamily A Member 1, MS4A1, MS4A2, S7) (MaxLight 550)
MBS6254517-01 0.1 mL

CD20 (CD20 Antigen, B1, B-lymphocyte Cell-surface Antigen B1, Bp35, CD20 Receptor, LEU-16, MGC3969, Membrane-spanning 4-domains Subfamily A Member 1, MS4A1, MS4A2, S7) (MaxLight 550)

Ask
View Details
CD20 (CD20 Antigen, B1, B-lymphocyte Cell-surface Antigen B1, Bp35, CD20 Receptor, LEU-16, MGC3969, Membrane-spanning 4-domains Subfamily A Member 1, MS4A1, MS4A2, S7) (MaxLight 550)
MBS6254517-02 5x 0.1 mL

CD20 (CD20 Antigen, B1, B-lymphocyte Cell-surface Antigen B1, Bp35, CD20 Receptor, LEU-16, MGC3969, Membrane-spanning 4-domains Subfamily A Member 1, MS4A1, MS4A2, S7) (MaxLight 550)

Ask
View Details
Forkhead Box protein P4 (FOXP4) Human ELISA Kit
90359 96 Tests

Forkhead Box protein P4 (FOXP4) Human ELISA Kit

Ask
View Details
Cyclin D1 (B cell CLL/lymphoma 1, B cell Leukemia 1, B Cell lymphoma 1 Protein, BCL-1 oncogene, CCND1 Protein, CCND1/FSTL3 fusion gene, CCND1/IGHG1 fusion gene CCND1/IGLC1 fusion gene, CCND1/PTH fusion gene, cD1, Cyl 1, G1/S-specific cyclin-D1, Parathyroid adenomatosis 1, PRAD1 oncogene) (Biotin)
172071-AF-Biotin 100 µL

Cyclin D1 (B cell CLL/lymphoma 1, B cell Leukemia 1, B Cell lymphoma 1 Protein, BCL-1 oncogene, CCND1 Protein, CCND1/FSTL3 fusion gene, CCND1/IGHG1 fusion gene CCND1/IGLC1 fusion gene, CCND1/PTH fusion gene, cD1, Cyl 1, G1/S-specific cyclin-D1, Parathyroid adenomatosis 1, PRAD1 oncogene) (Biotin)

Ask
View Details
ALX4 (NM_021926) Human Over-expression Lysate
LH11552V 100 µg

ALX4 (NM_021926) Human Over-expression Lysate

Ask
View Details