Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM16 Rabbit pAb (APR23841N)

Product Specifications

Background

The protein encoded by this gene is a tripartite motif (TRIM) family member that contains two B box domains and a coiled-coiled region that are characteristic of the B box zinc finger protein family. While it lacks a RING domain found in other TRIM proteins, the encoded protein can homodimerize or heterodimerize with other TRIM proteins and has E3 ubiquitin ligase activity. This gene is also a tumor suppressor and is involved in secretory autophagy. [provided by RefSeq, Jan 2017]

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TRIM16 Rabbit pAb (APR23841N) .

Synonyms

EBBP; TRIM16

Gene ID

10626

UniProt

O95361

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 64kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10626

Uniprot URL

https://www.uniprot.org/uniprot/O95361

AA Sequence

MAELDLMAPGPLPRATAQPPAPLSPDSGSPSPDSGSASPVEEEDVGSSEKLGRETEEQDSDSAEQGDPAGEGKEVLCDFCLDDTRRVKAVKSCLTCMVNYCEEHLQPHQVNIKLQSHLLTEPVKDHNWRYCPAHHSPLSAFCCPDQQCICQDCCQEHSGHTIVSLDAARRDKEAELQCTQLDLERKLKLNENAISRLQANQKSVLVSVSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CciNI, 100U
RE1248 100 U

CciNI, 100U

Sign In for Pricing
View Details
Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1125+ ARG1/1126), CF488A conjugate, 0.1mg/mL
BNC881143-500 1x 500 µL

Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1125+ ARG1/1126), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Gh activation kit by CRISPRa
GA201604 1 Kit

Mouse Gh activation kit by CRISPRa

Sign In for Pricing
View Details
UBFD1 Human Gene Knockout Kit (CRISPR)
KN419973 1 Kit

UBFD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human CD47/IAP Protein (His Tag)
PKSH033600-01 10 µg

Recombinant Human CD47/IAP Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CD47/IAP Protein (His Tag)
PKSH033600-02 50 µg

Recombinant Human CD47/IAP Protein (His Tag)

Sign In for Pricing
View Details