Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM16 Rabbit pAb (APR23841N)

Product Specifications

Background

The protein encoded by this gene is a tripartite motif (TRIM) family member that contains two B box domains and a coiled-coiled region that are characteristic of the B box zinc finger protein family. While it lacks a RING domain found in other TRIM proteins, the encoded protein can homodimerize or heterodimerize with other TRIM proteins and has E3 ubiquitin ligase activity. This gene is also a tumor suppressor and is involved in secretory autophagy. [provided by RefSeq, Jan 2017]

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TRIM16 Rabbit pAb (APR23841N) .

Synonyms

EBBP; TRIM16

Gene ID

10626

UniProt

O95361

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 64kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10626

Uniprot URL

https://www.uniprot.org/uniprot/O95361

AA Sequence

MAELDLMAPGPLPRATAQPPAPLSPDSGSPSPDSGSASPVEEEDVGSSEKLGRETEEQDSDSAEQGDPAGEGKEVLCDFCLDDTRRVKAVKSCLTCMVNYCEEHLQPHQVNIKLQSHLLTEPVKDHNWRYCPAHHSPLSAFCCPDQQCICQDCCQEHSGHTIVSLDAARRDKEAELQCTQLDLERKLKLNENAISRLQANQKSVLVSVSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TIMMDC1 activation kit by CRISPRa
GA109719 1 Kit

Human TIMMDC1 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Cecum
CR562071 5 µg

Tissue Total RNA, Cecum

Sign In for Pricing
View Details
C-Myc (MYC275), CF568 conjugate, 0.1mg/mL
BNC680275-500 1x 500 µL

C-Myc (MYC275), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Brivaracetam-d7 (Mixture of Diastereomers)
TRC-B677648-5MG 5 mg

Brivaracetam-d7 (Mixture of Diastereomers)

Sign In for Pricing
View Details
Mouse GROα/CXCL1 Antibody Pair Set
E-KAB-0318 50 µL & 100 µg

Mouse GROα/CXCL1 Antibody Pair Set

Sign In for Pricing
View Details
Human Anillin (ANLN) activation kit by CRISPRa
GA110104 1 Kit

Human Anillin (ANLN) activation kit by CRISPRa

Sign In for Pricing
View Details